Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 906073..906727 | Replicon | chromosome |
| Accession | NZ_OW849082 | ||
| Organism | Citrobacter freundii isolate 8 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | A0A0J1NHY7 |
| Locus tag | LQ154_RS04465 | Protein ID | WP_003026936.1 |
| Coordinates | 906320..906727 (+) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | A0A6H3AT26 |
| Locus tag | LQ154_RS04460 | Protein ID | WP_003026938.1 |
| Coordinates | 906073..906339 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ154_RS04435 (901273) | 901273..902706 | - | 1434 | WP_048218552.1 | 6-phospho-beta-glucosidase BglA | - |
| LQ154_RS04440 (902828) | 902828..903556 | - | 729 | WP_003838265.1 | MurR/RpiR family transcriptional regulator | - |
| LQ154_RS04445 (903609) | 903609..903920 | + | 312 | WP_044700802.1 | N(4)-acetylcytidine aminohydrolase | - |
| LQ154_RS04450 (904083) | 904083..904742 | + | 660 | WP_003026947.1 | hemolysin III family protein | - |
| LQ154_RS04455 (904836) | 904836..905816 | - | 981 | WP_119174530.1 | tRNA-modifying protein YgfZ | - |
| LQ154_RS04460 (906073) | 906073..906339 | + | 267 | WP_003026938.1 | FAD assembly factor SdhE | Antitoxin |
| LQ154_RS04465 (906320) | 906320..906727 | + | 408 | WP_003026936.1 | protein YgfX | Toxin |
| LQ154_RS04470 (906772) | 906772..907293 | - | 522 | WP_003026933.1 | flavodoxin FldB | - |
| LQ154_RS04475 (907407) | 907407..908303 | + | 897 | WP_003026928.1 | site-specific tyrosine recombinase XerD | - |
| LQ154_RS04480 (908327) | 908327..909040 | + | 714 | WP_230129561.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| LQ154_RS04485 (909046) | 909046..910779 | + | 1734 | WP_016150943.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 15953.89 Da Isoelectric Point: 11.4054
>T295635 WP_003026936.1 NZ_OW849082:906320-906727 [Citrobacter freundii]
VVQWQSDLRVSWRAQWLSLLIHGLVAVFILLMPWPLSYTPLWLVLLSLVVFDSVRSQRRINACQGEIRLLMDGRLRWQGQ
EWSIVSAPWMVKTGMMLRLRSDAGKRQHLWLAADSMDDAEWRDLRRLMLQKAKQK
VVQWQSDLRVSWRAQWLSLLIHGLVAVFILLMPWPLSYTPLWLVLLSLVVFDSVRSQRRINACQGEIRLLMDGRLRWQGQ
EWSIVSAPWMVKTGMMLRLRSDAGKRQHLWLAADSMDDAEWRDLRRLMLQKAKQK
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0J1NHY7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A6H3AT26 |