Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 780947..781735 | Replicon | chromosome |
| Accession | NZ_OW849082 | ||
| Organism | Citrobacter freundii isolate 8 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A7L6ILI8 |
| Locus tag | LQ154_RS03840 | Protein ID | WP_047359063.1 |
| Coordinates | 780947..781324 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | - |
| Locus tag | LQ154_RS03845 | Protein ID | WP_047359064.1 |
| Coordinates | 781376..781735 (-) | Length | 120 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ154_RS03820 (776969) | 776969..778828 | + | 1860 | WP_003838200.1 | bifunctional glutathionylspermidine amidase/synthase | - |
| LQ154_RS03825 (779300) | 779300..780148 | - | 849 | WP_088732394.1 | DUF4942 domain-containing protein | - |
| LQ154_RS03830 (780227) | 780227..780430 | - | 204 | WP_047359061.1 | DUF957 domain-containing protein | - |
| LQ154_RS03835 (780459) | 780459..780950 | - | 492 | WP_047359062.1 | DUF5983 family protein | - |
| LQ154_RS03840 (780947) | 780947..781324 | - | 378 | WP_047359063.1 | TA system toxin CbtA family protein | Toxin |
| LQ154_RS03845 (781376) | 781376..781735 | - | 360 | WP_047359064.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| LQ154_RS03850 (781759) | 781759..781980 | - | 222 | WP_000691982.1 | DUF987 domain-containing protein | - |
| LQ154_RS03855 (782001) | 782001..782480 | - | 480 | WP_047359065.1 | DNA repair protein RadC | - |
| LQ154_RS03860 (782492) | 782492..782953 | - | 462 | WP_047359066.1 | antirestriction protein | - |
| LQ154_RS03865 (783050) | 783050..783289 | - | 240 | WP_047359067.1 | DUF905 domain-containing protein | - |
| LQ154_RS03870 (783367) | 783367..783840 | - | 474 | WP_052951289.1 | hypothetical protein | - |
| LQ154_RS03875 (783862) | 783862..784557 | - | 696 | WP_047359068.1 | hypothetical protein | - |
| LQ154_RS03880 (784740) | 784740..785441 | - | 702 | WP_047359069.1 | WYL domain-containing protein | - |
| LQ154_RS03885 (785657) | 785657..786478 | - | 822 | WP_032751326.1 | DUF932 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14078.86 Da Isoelectric Point: 7.0606
>T295634 WP_047359063.1 NZ_OW849082:c781324-780947 [Citrobacter freundii]
VQTQPLSSTHETSPRPSPVDIWQHLLNHLLDRHYGLTLNDTPFGNDGVIQEHIDAGISLCDAVNFIVEKYDLVRTDRRGF
SADTQSPLIGSIDILRARKATGLMTRHGYRPVTDLITGKYKKEQQ
VQTQPLSSTHETSPRPSPVDIWQHLLNHLLDRHYGLTLNDTPFGNDGVIQEHIDAGISLCDAVNFIVEKYDLVRTDRRGF
SADTQSPLIGSIDILRARKATGLMTRHGYRPVTDLITGKYKKEQQ
Download Length: 378 bp
Antitoxin
Download Length: 120 a.a. Molecular weight: 13192.98 Da Isoelectric Point: 6.7434
>AT295634 WP_047359064.1 NZ_OW849082:c781735-781376 [Citrobacter freundii]
MSNKIPAENHDITEPWWGLKRSITPCFGARLVQEGNRLHYLGDRASIAGTFSDADLRHLDQAFPVQLKQLELMLVSGELN
PRHQHCVTLYSKGLTCEADSLGSHGYVYIAIYPTPAATA
MSNKIPAENHDITEPWWGLKRSITPCFGARLVQEGNRLHYLGDRASIAGTFSDADLRHLDQAFPVQLKQLELMLVSGELN
PRHQHCVTLYSKGLTCEADSLGSHGYVYIAIYPTPAATA
Download Length: 360 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|