Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 78629..79154 | Replicon | plasmid P1 |
| Accession | NZ_OW849065 | ||
| Organism | Escherichia coli isolate 131 | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | V0SSI5 |
| Locus tag | LQ135_RS26040 | Protein ID | WP_001159868.1 |
| Coordinates | 78849..79154 (+) | Length | 102 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | S1PPD8 |
| Locus tag | LQ135_RS26035 | Protein ID | WP_000813634.1 |
| Coordinates | 78629..78847 (+) | Length | 73 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ135_RS26010 (73908) | 73908..75521 | - | 1614 | WP_000080195.1 | IS66-like element ISEc23 family transposase | - |
| LQ135_RS26015 (75552) | 75552..75902 | - | 351 | WP_000624722.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| LQ135_RS26020 (75899) | 75899..76324 | - | 426 | WP_000422741.1 | transposase | - |
| LQ135_RS26025 (76416) | 76416..77537 | + | 1122 | WP_012783980.1 | DUF3800 domain-containing protein | - |
| LQ135_RS26030 (77571) | 77571..78059 | - | 489 | WP_011254646.1 | hypothetical protein | - |
| LQ135_RS26035 (78629) | 78629..78847 | + | 219 | WP_000813634.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
| LQ135_RS26040 (78849) | 78849..79154 | + | 306 | WP_001159868.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
| LQ135_RS26045 (79155) | 79155..79961 | + | 807 | WP_000016982.1 | site-specific integrase | - |
| LQ135_RS26050 (80735) | 80735..81490 | + | 756 | WP_000852146.1 | replication initiation protein RepE | - |
| LQ135_RS26055 (82078) | 82078..83244 | + | 1167 | WP_000772446.1 | plasmid-partitioning protein SopA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | tet(A) / blaOXA-1 / aac(6')-Ib-cr / blaCTX-M-15 / aadA5 / qacE / sul1 | - | 1..146311 | 146311 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11706.51 Da Isoelectric Point: 6.4674
>T295628 WP_001159868.1 NZ_OW849065:78849-79154 [Escherichia coli]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|