Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 71503..72146 Replicon plasmid P1
Accession NZ_OW849065
Organism Escherichia coli isolate 131

Toxin (Protein)


Gene name vagD Uniprot ID C7S9Y5
Locus tag LQ135_RS25990 Protein ID WP_001034046.1
Coordinates 71503..71919 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID V0SR71
Locus tag LQ135_RS25995 Protein ID WP_001261278.1
Coordinates 71916..72146 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LQ135_RS25975 (66640) 66640..67056 - 417 WP_001034044.1 type II toxin-antitoxin system VapC family toxin -
LQ135_RS25980 (67053) 67053..67283 - 231 WP_001261286.1 type II toxin-antitoxin system VapB family antitoxin -
LQ135_RS25985 (67664) 67664..71458 + 3795 WP_001144732.1 hypothetical protein -
LQ135_RS25990 (71503) 71503..71919 - 417 WP_001034046.1 type II toxin-antitoxin system VapC family toxin Toxin
LQ135_RS25995 (71916) 71916..72146 - 231 WP_001261278.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
LQ135_RS26000 (72411) 72411..72911 + 501 WP_000528932.1 HEPN family nuclease -
LQ135_RS26005 (72924) 72924..73697 + 774 WP_000905949.1 hypothetical protein -
LQ135_RS26010 (73908) 73908..75521 - 1614 WP_000080195.1 IS66-like element ISEc23 family transposase -
LQ135_RS26015 (75552) 75552..75902 - 351 WP_000624722.1 IS66 family insertion sequence element accessory protein TnpB -
LQ135_RS26020 (75899) 75899..76324 - 426 WP_000422741.1 transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid tet(A) / blaOXA-1 / aac(6')-Ib-cr / blaCTX-M-15 / aadA5 / qacE / sul1 - 1..146311 146311


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-53)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 14978.31 Da        Isoelectric Point: 6.7113

>T295627 WP_001034046.1 NZ_OW849065:c71919-71503 [Escherichia coli]
VNKIYMLDTNICSFIMREQPEAVLKNLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCARLDAILPWDRA
AVDATTEVKVALRLAGTPIGPNDTAIAGHAIATGAILVTNNVREFERVPGLVLEDWAG

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8853.07 Da        Isoelectric Point: 4.6437

>AT295627 WP_001261278.1 NZ_OW849065:c72146-71916 [Escherichia coli]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDRIILRPLRPSWSSFLELEKADPGFMTEREDVVCDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9NXF9

Antitoxin

Source ID Structure
AlphaFold DB V0SR71

References