Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 71503..72146 | Replicon | plasmid P1 |
| Accession | NZ_OW849065 | ||
| Organism | Escherichia coli isolate 131 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | C7S9Y5 |
| Locus tag | LQ135_RS25990 | Protein ID | WP_001034046.1 |
| Coordinates | 71503..71919 (-) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | V0SR71 |
| Locus tag | LQ135_RS25995 | Protein ID | WP_001261278.1 |
| Coordinates | 71916..72146 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ135_RS25975 (66640) | 66640..67056 | - | 417 | WP_001034044.1 | type II toxin-antitoxin system VapC family toxin | - |
| LQ135_RS25980 (67053) | 67053..67283 | - | 231 | WP_001261286.1 | type II toxin-antitoxin system VapB family antitoxin | - |
| LQ135_RS25985 (67664) | 67664..71458 | + | 3795 | WP_001144732.1 | hypothetical protein | - |
| LQ135_RS25990 (71503) | 71503..71919 | - | 417 | WP_001034046.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| LQ135_RS25995 (71916) | 71916..72146 | - | 231 | WP_001261278.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| LQ135_RS26000 (72411) | 72411..72911 | + | 501 | WP_000528932.1 | HEPN family nuclease | - |
| LQ135_RS26005 (72924) | 72924..73697 | + | 774 | WP_000905949.1 | hypothetical protein | - |
| LQ135_RS26010 (73908) | 73908..75521 | - | 1614 | WP_000080195.1 | IS66-like element ISEc23 family transposase | - |
| LQ135_RS26015 (75552) | 75552..75902 | - | 351 | WP_000624722.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| LQ135_RS26020 (75899) | 75899..76324 | - | 426 | WP_000422741.1 | transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | tet(A) / blaOXA-1 / aac(6')-Ib-cr / blaCTX-M-15 / aadA5 / qacE / sul1 | - | 1..146311 | 146311 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 14978.31 Da Isoelectric Point: 6.7113
>T295627 WP_001034046.1 NZ_OW849065:c71919-71503 [Escherichia coli]
VNKIYMLDTNICSFIMREQPEAVLKNLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCARLDAILPWDRA
AVDATTEVKVALRLAGTPIGPNDTAIAGHAIATGAILVTNNVREFERVPGLVLEDWAG
VNKIYMLDTNICSFIMREQPEAVLKNLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCARLDAILPWDRA
AVDATTEVKVALRLAGTPIGPNDTAIAGHAIATGAILVTNNVREFERVPGLVLEDWAG
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9NXF9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | V0SR71 |