Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 66640..67283 | Replicon | plasmid P1 |
| Accession | NZ_OW849065 | ||
| Organism | Escherichia coli isolate 131 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | V0UN72 |
| Locus tag | LQ135_RS25975 | Protein ID | WP_001034044.1 |
| Coordinates | 66640..67056 (-) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | B1P7N7 |
| Locus tag | LQ135_RS25980 | Protein ID | WP_001261286.1 |
| Coordinates | 67053..67283 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ135_RS25950 (62485) | 62485..62753 | + | 269 | Protein_77 | type II toxin-antitoxin system ParD family antitoxin | - |
| LQ135_RS25955 (62740) | 62740..63008 | + | 269 | Protein_78 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| LQ135_RS25960 (63042) | 63042..63739 | + | 698 | WP_095033700.1 | IS1-like element IS1B family transposase | - |
| LQ135_RS25965 (63993) | 63993..65015 | - | 1023 | WP_000361402.1 | helicase UvrD | - |
| LQ135_RS25970 (65000) | 65000..66565 | - | 1566 | WP_001128474.1 | AAA family ATPase | - |
| LQ135_RS25975 (66640) | 66640..67056 | - | 417 | WP_001034044.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| LQ135_RS25980 (67053) | 67053..67283 | - | 231 | WP_001261286.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| LQ135_RS25985 (67664) | 67664..71458 | + | 3795 | WP_001144732.1 | hypothetical protein | - |
| LQ135_RS25990 (71503) | 71503..71919 | - | 417 | WP_001034046.1 | type II toxin-antitoxin system VapC family toxin | - |
| LQ135_RS25995 (71916) | 71916..72146 | - | 231 | WP_001261278.1 | type II toxin-antitoxin system VapB family antitoxin | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | tet(A) / blaOXA-1 / aac(6')-Ib-cr / blaCTX-M-15 / aadA5 / qacE / sul1 | - | 1..146311 | 146311 | |
| - | flank | IS/Tn | - | - | 63362..63739 | 377 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15232.66 Da Isoelectric Point: 6.8536
>T295626 WP_001034044.1 NZ_OW849065:c67056-66640 [Escherichia coli]
VNKIYMLDTNICSFIMREQPEALLKHLEQSVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAACAILVTNNVREFERVPGLVLEDWVR
VNKIYMLDTNICSFIMREQPEALLKHLEQSVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAACAILVTNNVREFERVPGLVLEDWVR
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CHW1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CKZ6 |