Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4051922..4052757 | Replicon | chromosome |
| Accession | NZ_OW849064 | ||
| Organism | Escherichia coli isolate 131 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A0J2AEA6 |
| Locus tag | LQ135_RS20040 | Protein ID | WP_000854759.1 |
| Coordinates | 4052380..4052757 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | S1NM52 |
| Locus tag | LQ135_RS20035 | Protein ID | WP_001295723.1 |
| Coordinates | 4051922..4052290 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ135_RS20010 (4047924) | 4047924..4048397 | + | 474 | WP_001350782.1 | antirestriction protein | - |
| LQ135_RS20015 (4048413) | 4048413..4048889 | + | 477 | WP_001186775.1 | RadC family protein | - |
| LQ135_RS20020 (4048952) | 4048952..4049206 | + | 255 | WP_023281719.1 | DUF987 domain-containing protein | - |
| LQ135_RS20025 (4049347) | 4049347..4050888 | + | 1542 | WP_001298859.1 | IS21-like element ISEc12 family transposase | - |
| LQ135_RS20030 (4050903) | 4050903..4051649 | + | 747 | WP_001016257.1 | IS21-like element ISEc12 family helper ATPase IstB | - |
| LQ135_RS20035 (4051922) | 4051922..4052290 | + | 369 | WP_001295723.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| LQ135_RS20040 (4052380) | 4052380..4052757 | + | 378 | WP_000854759.1 | TA system toxin CbtA family protein | Toxin |
| LQ135_RS20045 (4052754) | 4052754..4053242 | + | 489 | WP_000761690.1 | DUF5983 family protein | - |
| LQ135_RS20050 (4053259) | 4053259..4053435 | + | 177 | WP_000839286.1 | DUF957 domain-containing protein | - |
| LQ135_RS20055 (4053541) | 4053541..4053690 | + | 150 | Protein_3926 | hypothetical protein | - |
| LQ135_RS20060 (4054057) | 4054057..4054233 | + | 177 | Protein_3927 | helix-turn-helix domain-containing protein | - |
| LQ135_RS20065 (4055024) | 4055024..4056646 | + | 1623 | WP_001295726.1 | Alw26I/Eco31I/Esp3I family type II restriction adenine-specific DNA-methyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14144.26 Da Isoelectric Point: 7.3249
>T295618 WP_000854759.1 NZ_OW849064:4052380-4052757 [Escherichia coli]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13592.40 Da Isoelectric Point: 6.6255
>AT295618 WP_001295723.1 NZ_OW849064:4051922-4052290 [Escherichia coli]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0J2AEA6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | S1NM52 |