Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 3237911..3238746 | Replicon | chromosome |
| Accession | NZ_OW849064 | ||
| Organism | Escherichia coli isolate 131 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A376WVB1 |
| Locus tag | LQ135_RS16055 | Protein ID | WP_001094448.1 |
| Coordinates | 3238369..3238746 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A3T7EC32 |
| Locus tag | LQ135_RS16050 | Protein ID | WP_024175935.1 |
| Coordinates | 3237911..3238279 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ135_RS16025 (3235340) | 3235340..3235573 | + | 234 | WP_001117568.1 | DUF905 family protein | - |
| LQ135_RS16030 (3235664) | 3235664..3236482 | + | 819 | WP_001234753.1 | DUF932 domain-containing protein | - |
| LQ135_RS16035 (3236574) | 3236574..3237059 | + | 486 | WP_000214415.1 | antirestriction protein | - |
| LQ135_RS16040 (3237071) | 3237071..3237547 | + | 477 | WP_001186709.1 | RadC family protein | - |
| LQ135_RS16045 (3237616) | 3237616..3237837 | + | 222 | WP_000692346.1 | DUF987 domain-containing protein | - |
| LQ135_RS16050 (3237911) | 3237911..3238279 | + | 369 | WP_024175935.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| LQ135_RS16055 (3238369) | 3238369..3238746 | + | 378 | WP_001094448.1 | TA system toxin CbtA family protein | Toxin |
| LQ135_RS16060 (3238743) | 3238743..3239231 | + | 489 | WP_000761714.1 | DUF5983 family protein | - |
| LQ135_RS16065 (3239243) | 3239243..3239435 | + | 193 | Protein_3160 | hypothetical protein | - |
| LQ135_RS16070 (3239520) | 3239520..3240365 | + | 846 | WP_000065751.1 | DUF4942 domain-containing protein | - |
| LQ135_RS16075 (3240958) | 3240958..3241455 | + | 498 | WP_000509815.1 | hypothetical protein | - |
| LQ135_RS16080 (3241633) | 3241633..3242556 | + | 924 | WP_000535950.1 | carboxylate/amino acid/amine transporter | - |
| LQ135_RS16085 (3242560) | 3242560..3243378 | - | 819 | WP_000779409.1 | lipoprotein NlpA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 3230380..3241455 | 11075 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14221.22 Da Isoelectric Point: 8.2919
>T295614 WP_001094448.1 NZ_OW849064:3238369-3238746 [Escherichia coli]
MNTLPDTHVREASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKR
MNTLPDTHVREASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13598.40 Da Isoelectric Point: 6.6255
>AT295614 WP_024175935.1 NZ_OW849064:3237911-3238279 [Escherichia coli]
VSDTLSGTTHPDDNDDRLWWGLPCTVTPCFGARLVQKGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
VSDTLSGTTHPDDNDDRLWWGLPCTVTPCFGARLVQKGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A376WVB1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3T7EC32 |