Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ataRT/DUF1778(antitoxin) |
| Location | 2925652..2926452 | Replicon | chromosome |
| Accession | NZ_OW849064 | ||
| Organism | Escherichia coli isolate 131 | ||
Toxin (Protein)
| Gene name | ataT | Uniprot ID | F4T503 |
| Locus tag | LQ135_RS14635 | Protein ID | WP_000342452.1 |
| Coordinates | 2925652..2926179 (-) | Length | 176 a.a. |
Antitoxin (Protein)
| Gene name | ataR | Uniprot ID | F4T504 |
| Locus tag | LQ135_RS14640 | Protein ID | WP_001277107.1 |
| Coordinates | 2926186..2926452 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ135_RS14610 (2920728) | 2920728..2921495 | - | 768 | WP_000082099.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
| LQ135_RS14615 (2921492) | 2921492..2922769 | - | 1278 | WP_000803819.1 | branched chain amino acid ABC transporter permease LivM | - |
| LQ135_RS14620 (2922766) | 2922766..2923692 | - | 927 | WP_001295097.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
| LQ135_RS14625 (2923740) | 2923740..2924849 | - | 1110 | WP_230181303.1 | high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK | - |
| LQ135_RS14630 (2925272) | 2925272..2925655 | + | 384 | WP_000778796.1 | aspartate 1-decarboxylase autocleavage activator PanM | - |
| LQ135_RS14635 (2925652) | 2925652..2926179 | - | 528 | WP_000342452.1 | type II toxin-antitoxin system toxin acetyltransferase AtaT | Toxin |
| LQ135_RS14640 (2926186) | 2926186..2926452 | - | 267 | WP_001277107.1 | type II toxin-antitoxin system antitoxin AtaR | Antitoxin |
| LQ135_RS14645 (2926601) | 2926601..2927704 | - | 1104 | WP_001021994.1 | branched chain amino acid ABC transporter substrate-binding protein LivJ | - |
| LQ135_RS14650 (2927975) | 2927975..2928829 | - | 855 | WP_000130217.1 | RNA polymerase sigma factor RpoH | - |
| LQ135_RS14655 (2929074) | 2929074..2930132 | - | 1059 | WP_001042013.1 | permease-like cell division protein FtsX | - |
| LQ135_RS14660 (2930125) | 2930125..2930793 | - | 669 | WP_000617723.1 | cell division ATP-binding protein FtsE | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19673.57 Da Isoelectric Point: 6.6348
>T295613 WP_000342452.1 NZ_OW849064:c2926179-2925652 [Escherichia coli]
MDDLTIEILTDDADYDLQRFDCGEEALNLFLTTHLVRQHRNKILRAYILCRNTPERQVLGYYTLSGSCFERAALPSKSKQ
KKIPYKNIPSVTLGRLAIDRSLQGQGWGATLVAHAMKVVWSASLAVGIHGLFVEALNEKAHTFYQSLGFIPLVGENENAL
FFPTKSIELLFTPDD
MDDLTIEILTDDADYDLQRFDCGEEALNLFLTTHLVRQHRNKILRAYILCRNTPERQVLGYYTLSGSCFERAALPSKSKQ
KKIPYKNIPSVTLGRLAIDRSLQGQGWGATLVAHAMKVVWSASLAVGIHGLFVEALNEKAHTFYQSLGFIPLVGENENAL
FFPTKSIELLFTPDD
Download Length: 528 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A061K5K9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A061YQ57 |