Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 2394441..2395275 | Replicon | chromosome |
| Accession | NZ_OW849064 | ||
| Organism | Escherichia coli isolate 131 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A8E0IX31 |
| Locus tag | LQ135_RS12000 | Protein ID | WP_000854689.1 |
| Coordinates | 2394898..2395275 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A1X3JHN3 |
| Locus tag | LQ135_RS11995 | Protein ID | WP_001285598.1 |
| Coordinates | 2394441..2394821 (+) | Length | 127 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ135_RS11960 (2390724) | 2390724..2391179 | + | 456 | WP_000581502.1 | IrmA family protein | - |
| LQ135_RS11965 (2391284) | 2391284..2391493 | + | 210 | WP_032142237.1 | DUF905 family protein | - |
| LQ135_RS11970 (2391594) | 2391594..2392412 | + | 819 | WP_001234620.1 | DUF932 domain-containing protein | - |
| LQ135_RS11975 (2392467) | 2392467..2392952 | + | 486 | WP_000849566.1 | antirestriction protein | - |
| LQ135_RS11980 (2392968) | 2392968..2393444 | + | 477 | WP_001186726.1 | RadC family protein | - |
| LQ135_RS11985 (2393507) | 2393507..2393728 | + | 222 | WP_000692329.1 | DUF987 domain-containing protein | - |
| LQ135_RS11990 (2393747) | 2393747..2394391 | + | 645 | WP_000094916.1 | hypothetical protein | - |
| LQ135_RS11995 (2394441) | 2394441..2394821 | + | 381 | WP_001285598.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| LQ135_RS12000 (2394898) | 2394898..2395275 | + | 378 | WP_000854689.1 | TA system toxin CbtA family protein | Toxin |
| LQ135_RS12005 (2395272) | 2395272..2395760 | + | 489 | WP_000761699.1 | DUF5983 family protein | - |
| LQ135_RS12010 (2395777) | 2395777..2395974 | + | 198 | WP_000839293.1 | DUF957 domain-containing protein | - |
| LQ135_RS12015 (2396059) | 2396059..2396904 | + | 846 | WP_023281696.1 | DUF4942 domain-containing protein | - |
| LQ135_RS12020 (2396973) | 2396973..2397368 | + | 396 | WP_000208383.1 | DUF6088 family protein | - |
| LQ135_RS12025 (2397361) | 2397361..2398254 | + | 894 | WP_001114681.1 | nucleotidyl transferase AbiEii/AbiGii toxin family protein | - |
| LQ135_RS12030 (2398725) | 2398725..2398895 | + | 171 | Protein_2366 | IS110 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14042.07 Da Isoelectric Point: 9.1510
>T295609 WP_000854689.1 NZ_OW849064:2394898-2395275 [Escherichia coli]
MKTLPDTHVRAASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKR
MKTLPDTHVRAASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 127 a.a. Molecular weight: 13927.72 Da Isoelectric Point: 4.7959
>AT295609 WP_001285598.1 NZ_OW849064:2394441-2394821 [Escherichia coli]
MSDTLPGTTLPDDNKDLPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSNADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCDADTLGSCGYVYLAVYPATETESNPPE
MSDTLPGTTLPDDNKDLPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSNADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCDADTLGSCGYVYLAVYPATETESNPPE
Download Length: 381 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|