Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 2248105..2248759 | Replicon | chromosome |
Accession | NZ_OW849064 | ||
Organism | Escherichia coli isolate 131 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | F4T2L4 |
Locus tag | LQ135_RS11225 | Protein ID | WP_000244765.1 |
Coordinates | 2248105..2248512 (-) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | F4T2L5 |
Locus tag | LQ135_RS11230 | Protein ID | WP_000354050.1 |
Coordinates | 2248493..2248759 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LQ135_RS11205 (2244062) | 2244062..2245795 | - | 1734 | WP_000813195.1 | single-stranded-DNA-specific exonuclease RecJ | - |
LQ135_RS11210 (2245801) | 2245801..2246511 | - | 711 | WP_000715230.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
LQ135_RS11215 (2246536) | 2246536..2247432 | - | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
LQ135_RS11220 (2247544) | 2247544..2248065 | + | 522 | WP_001055874.1 | flavodoxin FldB | - |
LQ135_RS11225 (2248105) | 2248105..2248512 | - | 408 | WP_000244765.1 | protein YgfX | Toxin |
LQ135_RS11230 (2248493) | 2248493..2248759 | - | 267 | WP_000354050.1 | FAD assembly factor SdhE | Antitoxin |
LQ135_RS11235 (2249002) | 2249002..2249982 | + | 981 | WP_000886084.1 | tRNA-modifying protein YgfZ | - |
LQ135_RS11240 (2250059) | 2250059..2250718 | - | 660 | WP_000250275.1 | hemolysin III family protein | - |
LQ135_RS11245 (2250882) | 2250882..2251193 | - | 312 | WP_001182956.1 | N(4)-acetylcytidine aminohydrolase | - |
LQ135_RS11250 (2251238) | 2251238..2252671 | + | 1434 | WP_001296350.1 | 6-phospho-beta-glucosidase BglA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16043.95 Da Isoelectric Point: 11.5202
>T295608 WP_000244765.1 NZ_OW849064:c2248512-2248105 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLIPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLIPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A454A7D7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A061L3F4 |