295606

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 1313859..1314690 Replicon chromosome
Accession NZ_OW849064
Organism Escherichia coli isolate 131

Toxin (Protein)


Gene name yeeV Uniprot ID A0A066T988
Locus tag LQ135_RS07010 Protein ID WP_000854815.1
Coordinates 1314316..1314690 (+) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A061Y7A8
Locus tag LQ135_RS07005 Protein ID WP_001280918.1
Coordinates 1313859..1314227 (+) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LQ135_RS06965 (1308945) 1308945..1309691 + 747 WP_001016257.1 IS21-like element ISEc12 family helper ATPase IstB -
LQ135_RS06970 (1309774) 1309774..1310124 + 351 Protein_1375 hypothetical protein -
LQ135_RS06975 (1310140) 1310140..1310550 + 411 WP_000846703.1 hypothetical protein -
LQ135_RS06980 (1310771) 1310771..1311589 + 819 WP_001542275.1 DUF932 domain-containing protein -
LQ135_RS06985 (1311931) 1311931..1312404 + 474 WP_001542276.1 antirestriction protein -
LQ135_RS06990 (1312420) 1312420..1312896 + 477 WP_001186200.1 RadC family protein -
LQ135_RS06995 (1312959) 1312959..1313180 + 222 WP_000692345.1 DUF987 domain-containing protein -
LQ135_RS07000 (1313199) 1313199..1313843 + 645 WP_000086752.1 hypothetical protein -
LQ135_RS07005 (1313859) 1313859..1314227 + 369 WP_001280918.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
LQ135_RS07010 (1314316) 1314316..1314690 + 375 WP_000854815.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
LQ135_RS07015 (1314687) 1314687..1314881 + 195 WP_000988600.1 DUF5983 family protein -
LQ135_RS07020 (1314927) 1314927..1315007 + 81 Protein_1385 hypothetical protein -
LQ135_RS07025 (1315296) 1315296..1315376 - 81 WP_023441679.1 hypothetical protein -
LQ135_RS07030 (1315355) 1315355..1315678 + 324 WP_225469267.1 EutP/PduV family microcompartment system protein -
LQ135_RS07035 (1315779) 1315779..1316108 - 330 WP_000450409.1 DUF496 family protein -
LQ135_RS07040 (1316280) 1316280..1317338 - 1059 WP_001200889.1 FUSC family protein -
LQ135_RS07045 (1317536) 1317536..1318009 - 474 WP_001105368.1 DNA gyrase inhibitor SbmC -
LQ135_RS07050 (1318128) 1318128..1319294 - 1167 WP_001296209.1 serine-type D-Ala-D-Ala carboxypeptidase DacD -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(19-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13829.83 Da        Isoelectric Point: 7.1326

>T295606 WP_000854815.1 NZ_OW849064:1314316-1314690 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTSDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13811.70 Da        Isoelectric Point: 6.4767

>AT295606 WP_001280918.1 NZ_OW849064:1313859-1314227 [Escherichia coli]
VSDKLHETNYPDDHNDRLWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A066T988

Antitoxin

Source ID Structure
AlphaFold DB A0A061Y7A8

References