Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-VagC
Location 86434..87059 Replicon plasmid P1
Accession NZ_OW848981
Organism Escherichia coli isolate 23

Toxin (Protein)


Gene name vapC Uniprot ID -
Locus tag LQ157_RS24260 Protein ID WP_000911313.1
Coordinates 86661..87059 (+) Length 133 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID V0VCB2
Locus tag LQ157_RS24255 Protein ID WP_000450520.1
Coordinates 86434..86661 (+) Length 76 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LQ157_RS24245 (81696) 81696..82442 - 747 WP_000205749.1 conjugal transfer pilus acetylase TraX -
LQ157_RS24250 (82462) 82462..86352 - 3891 WP_116838173.1 MobF family relaxase -
LQ157_RS24255 (86434) 86434..86661 + 228 WP_000450520.1 toxin-antitoxin system antitoxin VapB Antitoxin
LQ157_RS24260 (86661) 86661..87059 + 399 WP_000911313.1 type II toxin-antitoxin system VapC family toxin Toxin
LQ157_RS24265 (87068) 87068..88708 - 1641 Protein_92 type IV conjugative transfer system coupling protein TraD -
LQ157_RS24270 (88707) 88707..89180 - 474 Protein_93 TraC family protein -
LQ157_RS24275 (89340) 89340..89561 - 222 WP_001278689.1 conjugal transfer protein TraR -
LQ157_RS24280 (89696) 89696..90211 - 516 WP_000809838.1 type IV conjugative transfer system lipoprotein TraV -
LQ157_RS24285 (90208) 90208..90459 - 252 WP_001038342.1 conjugal transfer protein TrbG -
LQ157_RS24290 (90471) 90471..90668 - 198 WP_001324648.1 conjugal transfer protein TrbD -
LQ157_RS24295 (90655) 90655..91245 - 591 WP_001376242.1 conjugal transfer pilus-stabilizing protein TraP -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid tet(A) / sul2 / aph(3'')-Ib / aph(6)-Id / dfrA1 / ant(3'')-Ia / qacE / sul1 / mph(B) / sitABCD iroB / iroC / iroD / iroE / iroN / iutA / iucD / iucC / iucB / iucA 1..125197 125197


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-125)

Antitoxin

SpoVT-AbrB domain

(8-50)


Sequences

Toxin        


Download         Length: 133 a.a.        Molecular weight: 14901.15 Da        Isoelectric Point: 7.8605

>T295588 WP_000911313.1 NZ_OW848981:86661-87059 [Escherichia coli]
MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHS
GQIRAELARQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVDGLRIEDWS

Download         Length: 399 bp

Antitoxin


Download         Length: 76 a.a.        Molecular weight: 8596.63 Da        Isoelectric Point: 4.7513

>AT295588 WP_000450520.1 NZ_OW848981:86434-86661 [Escherichia coli]
METTVFFSNRSQAVRLPKAVALPENVKRVEVIAVGRTRIITPAGETWDEWFDGHNVSADFMDNREQPGMQERESF

Download         Length: 228 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB V0VCB2

References