Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 33772..34415 Replicon plasmid P1
Accession NZ_OW848981
Organism Escherichia coli isolate 23

Toxin (Protein)


Gene name vagD Uniprot ID B1LRW4
Locus tag LQ157_RS23940 Protein ID WP_001044768.1
Coordinates 33999..34415 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID D2WFK3
Locus tag LQ157_RS23935 Protein ID WP_001261287.1
Coordinates 33772..34002 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LQ157_RS23915 (29892) 29892..30860 - 969 WP_100620302.1 IS5-like element IS903B family transposase -
LQ157_RS23920 (31021) 31021..32247 + 1227 WP_224729366.1 hypothetical protein -
LQ157_RS23925 (32297) 32297..33196 - 900 WP_000963206.1 nucleotide-binding protein -
LQ157_RS23930 (33186) 33186..33476 - 291 WP_000111771.1 hypothetical protein -
LQ157_RS23935 (33772) 33772..34002 + 231 WP_001261287.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
LQ157_RS23940 (33999) 33999..34415 + 417 WP_001044768.1 type II toxin-antitoxin system VapC family toxin Toxin
LQ157_RS23945 (34577) 34577..36715 - 2139 WP_000350638.1 AAA family ATPase -
LQ157_RS23950 (37069) 37069..37326 + 258 WP_000343085.1 hypothetical protein -
LQ157_RS23955 (37326) 37326..37916 + 591 WP_000194575.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid tet(A) / sul2 / aph(3'')-Ib / aph(6)-Id / dfrA1 / ant(3'')-Ia / qacE / sul1 / mph(B) / sitABCD iroB / iroC / iroD / iroE / iroN / iutA / iucD / iucC / iucB / iucA 1..125197 125197
- flank IS/Tn - - 29892..30860 968


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-52)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15197.66 Da        Isoelectric Point: 7.7805

>T295583 WP_001044768.1 NZ_OW848981:33999-34415 [Escherichia coli]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8815.90 Da        Isoelectric Point: 4.3775

>AT295583 WP_001261287.1 NZ_OW848981:33772-34002 [Escherichia coli]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFLEYEKADPDFMAEREDVVSDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A606Q844

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9QFC4

References