Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PanAT/DUF4065(antitoxin) |
Location | 4478220..4479264 | Replicon | chromosome |
Accession | NZ_OW848980 | ||
Organism | Escherichia coli isolate 23 |
Toxin (Protein)
Gene name | panT | Uniprot ID | A0A829CP20 |
Locus tag | LQ157_RS21940 | Protein ID | WP_000019186.1 |
Coordinates | 4478220..4478768 (-) | Length | 183 a.a. |
Antitoxin (Protein)
Gene name | panA | Uniprot ID | A0A839B6W4 |
Locus tag | LQ157_RS21945 | Protein ID | WP_000287252.1 |
Coordinates | 4478791..4479264 (-) | Length | 158 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LQ157_RS21905 (4473432) | 4473432..4473983 | - | 552 | WP_000515860.1 | protein YmfL | - |
LQ157_RS21910 (4474027) | 4474027..4474227 | - | 201 | WP_000649477.1 | YdaS family helix-turn-helix protein | - |
LQ157_RS21915 (4474318) | 4474318..4474992 | + | 675 | WP_000859462.1 | LexA family transcriptional repressor | - |
LQ157_RS21920 (4475659) | 4475659..4476021 | + | 363 | WP_000135682.1 | protein YfdP | - |
LQ157_RS21925 (4476087) | 4476087..4476911 | + | 825 | WP_015364383.1 | DUF2303 family protein | - |
LQ157_RS21930 (4477098) | 4477098..4477880 | + | 783 | WP_000610754.1 | hypothetical protein | - |
LQ157_RS21935 (4477917) | 4477917..4478186 | + | 270 | WP_001093912.1 | pyocin activator PrtN family protein | - |
LQ157_RS21940 (4478220) | 4478220..4478768 | - | 549 | WP_000019186.1 | hypothetical protein | Toxin |
LQ157_RS21945 (4478791) | 4478791..4479264 | - | 474 | WP_000287252.1 | DUF4065 domain-containing protein | Antitoxin |
LQ157_RS21950 (4479569) | 4479569..4479673 | - | 105 | Protein_4310 | tRNA-dihydrouridine synthase | - |
LQ157_RS21955 (4480036) | 4480036..4480776 | - | 741 | WP_001324389.1 | DUF2713 family protein | - |
LQ157_RS25450 (4480771) | 4480771..4481052 | - | 282 | Protein_4312 | DUF2713 domain-containing protein | - |
LQ157_RS21960 (4481370) | 4481370..4481885 | + | 516 | WP_001295691.1 | zinc uptake transcriptional repressor Zur | - |
LQ157_RS21965 (4481927) | 4481927..4482136 | - | 210 | WP_001030593.1 | CsbD family protein | - |
LQ157_RS21970 (4482252) | 4482252..4483577 | - | 1326 | WP_001301116.1 | MATE family efflux transporter DinF | - |
LQ157_RS21975 (4483650) | 4483650..4484258 | - | 609 | WP_000646078.1 | transcriptional repressor LexA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 4456775..4484258 | 27483 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 183 a.a. Molecular weight: 20026.39 Da Isoelectric Point: 4.4481
>T295582 WP_000019186.1 NZ_OW848980:c4478768-4478220 [Escherichia coli]
MSHNSDIYKLIGAAAGVENGRSEASLNSTDSQEQAFESAFEPSNHERDDDSSSENKAILEEEEFGSNTGALHEFMQQNRM
DSLQAQLDMLKSQVRDKIADATGKEIDNELRTKMASFTVWFMSCWCLFVVAMFTSFLIAHEGKAPVEAIVALLGTSTISI
VGLVGFVVSGLFKSRKDSDKEK
MSHNSDIYKLIGAAAGVENGRSEASLNSTDSQEQAFESAFEPSNHERDDDSSSENKAILEEEEFGSNTGALHEFMQQNRM
DSLQAQLDMLKSQVRDKIADATGKEIDNELRTKMASFTVWFMSCWCLFVVAMFTSFLIAHEGKAPVEAIVALLGTSTISI
VGLVGFVVSGLFKSRKDSDKEK
Download Length: 549 bp
Antitoxin
Download Length: 158 a.a. Molecular weight: 17298.80 Da Isoelectric Point: 8.4143
>AT295582 WP_000287252.1 NZ_OW848980:c4479264-4478791 [Escherichia coli]
MYSPVQIANKFITLGNQHHNPLTHMQLQKLTYIAHGYYLALTGKPLLNECVSAWKYGPVIPGMYDAFKDYGNKPVTNVAV
APFGGIVTMDPQAESIIGAVYKFYGSKNGIELSTLTHMPGTPWSQAYNGIGSSIISNDAIKAYYHDLLNNRQQCQGL
MYSPVQIANKFITLGNQHHNPLTHMQLQKLTYIAHGYYLALTGKPLLNECVSAWKYGPVIPGMYDAFKDYGNKPVTNVAV
APFGGIVTMDPQAESIIGAVYKFYGSKNGIELSTLTHMPGTPWSQAYNGIGSSIISNDAIKAYYHDLLNNRQQCQGL
Download Length: 474 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CP20 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A839B6W4 |