Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3548993..3549611 | Replicon | chromosome |
Accession | NZ_OW848980 | ||
Organism | Escherichia coli isolate 23 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | LQ157_RS17415 | Protein ID | WP_001291435.1 |
Coordinates | 3549393..3549611 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | LQ157_RS17410 | Protein ID | WP_000344800.1 |
Coordinates | 3548993..3549367 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LQ157_RS17400 (3544082) | 3544082..3545275 | + | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
LQ157_RS17405 (3545298) | 3545298..3548447 | + | 3150 | WP_001132469.1 | efflux RND transporter permease AcrB | - |
LQ157_RS17410 (3548993) | 3548993..3549367 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
LQ157_RS17415 (3549393) | 3549393..3549611 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
LQ157_RS17420 (3549783) | 3549783..3550334 | + | 552 | WP_000102568.1 | maltose O-acetyltransferase | - |
LQ157_RS17425 (3550450) | 3550450..3550920 | + | 471 | WP_000136192.1 | YlaC family protein | - |
LQ157_RS17430 (3551084) | 3551084..3552634 | + | 1551 | WP_001299455.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
LQ157_RS17435 (3552676) | 3552676..3553029 | - | 354 | Protein_3421 | DUF1428 family protein | - |
LQ157_RS17445 (3553408) | 3553408..3553719 | + | 312 | WP_000409911.1 | MGMT family protein | - |
LQ157_RS17450 (3553750) | 3553750..3554322 | - | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T295578 WP_001291435.1 NZ_OW848980:3549393-3549611 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT295578 WP_000344800.1 NZ_OW848980:3548993-3549367 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |