Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 1341143..1341768 | Replicon | chromosome |
| Accession | NZ_OW848980 | ||
| Organism | Escherichia coli isolate 23 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | LQ157_RS06520 | Protein ID | WP_000911330.1 |
| Coordinates | 1341370..1341768 (+) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | U9XQV3 |
| Locus tag | LQ157_RS06515 | Protein ID | WP_000450524.1 |
| Coordinates | 1341143..1341370 (+) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ157_RS06490 (1336946) | 1336946..1337416 | - | 471 | WP_001068682.1 | thioredoxin-dependent thiol peroxidase | - |
| LQ157_RS06495 (1337416) | 1337416..1337988 | - | 573 | WP_000176187.1 | glycine cleavage system transcriptional repressor | - |
| LQ157_RS06500 (1338134) | 1338134..1339012 | + | 879 | WP_001295469.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
| LQ157_RS06505 (1339029) | 1339029..1340063 | + | 1035 | WP_001297320.1 | outer membrane protein assembly factor BamC | - |
| LQ157_RS06510 (1340276) | 1340276..1340989 | + | 714 | WP_001295467.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
| LQ157_RS06515 (1341143) | 1341143..1341370 | + | 228 | WP_000450524.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
| LQ157_RS06520 (1341370) | 1341370..1341768 | + | 399 | WP_000911330.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| LQ157_RS06525 (1341915) | 1341915..1342778 | + | 864 | WP_001267507.1 | neutral zinc metallopeptidase | - |
| LQ157_RS06530 (1342793) | 1342793..1344808 | + | 2016 | WP_000829323.1 | tRNA cytosine(34) acetyltransferase TmcA | - |
| LQ157_RS06535 (1344882) | 1344882..1345580 | + | 699 | WP_000679823.1 | esterase | - |
| LQ157_RS06540 (1345690) | 1345690..1345890 | - | 201 | WP_000383836.1 | YpfN family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14894.25 Da Isoelectric Point: 9.2216
>T295571 WP_000911330.1 NZ_OW848980:1341370-1341768 [Escherichia coli]
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|