Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4474406..4474922 | Replicon | chromosome |
Accession | NZ_OW848788 | ||
Organism | Citrobacter freundii isolate 112 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | LQ087_RS21825 | Protein ID | WP_044699148.1 |
Coordinates | 4474406..4474690 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A0J1MV10 |
Locus tag | LQ087_RS21830 | Protein ID | WP_003839576.1 |
Coordinates | 4474680..4474922 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LQ087_RS21810 (4470731) | 4470731..4471315 | + | 585 | WP_003844920.1 | fructose PTS transporter subunit IIA | - |
LQ087_RS21815 (4471693) | 4471693..4473831 | + | 2139 | WP_048234081.1 | anaerobic ribonucleoside-triphosphate reductase | - |
LQ087_RS21820 (4473938) | 4473938..4474402 | + | 465 | WP_032937736.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
LQ087_RS21825 (4474406) | 4474406..4474690 | - | 285 | WP_044699148.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
LQ087_RS21830 (4474680) | 4474680..4474922 | - | 243 | WP_003839576.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
LQ087_RS21835 (4475000) | 4475000..4476913 | - | 1914 | WP_003839574.1 | BglG family transcription antiterminator | - |
LQ087_RS21840 (4476935) | 4476935..4477675 | - | 741 | WP_003025772.1 | KDGP aldolase family protein | - |
LQ087_RS21845 (4477672) | 4477672..4478790 | - | 1119 | WP_003025770.1 | DgaE family pyridoxal phosphate-dependent ammonia lyase | - |
LQ087_RS21850 (4478774) | 4478774..4479907 | - | 1134 | WP_016149471.1 | amidohydrolase/deacetylase family metallohydrolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10865.69 Da Isoelectric Point: 10.1988
>T295560 WP_044699148.1 NZ_OW848788:c4474690-4474406 [Citrobacter freundii]
MTYELEFDPRALKEWHKLGDTVKAQFKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDEVVTVFVVAVGK
RQHSAVYLDANKRL
MTYELEFDPRALKEWHKLGDTVKAQFKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDEVVTVFVVAVGK
RQHSAVYLDANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|