Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | shpAB/BrnT-BrnA |
Location | 4336765..4337341 | Replicon | chromosome |
Accession | NZ_OW848788 | ||
Organism | Citrobacter freundii isolate 112 |
Toxin (Protein)
Gene name | shpA | Uniprot ID | - |
Locus tag | LQ087_RS21235 | Protein ID | WP_003019170.1 |
Coordinates | 4337054..4337341 (-) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | shpB | Uniprot ID | - |
Locus tag | LQ087_RS21230 | Protein ID | WP_230122311.1 |
Coordinates | 4336765..4337067 (-) | Length | 101 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LQ087_RS21210 (4332487) | 4332487..4333035 | + | 549 | WP_003845610.1 | hypothetical protein | - |
LQ087_RS21215 (4333278) | 4333278..4335428 | + | 2151 | WP_003845609.1 | pyruvate/proton symporter BtsT | - |
LQ087_RS21220 (4335539) | 4335539..4335733 | + | 195 | WP_003830038.1 | YbdD/YjiX family protein | - |
LQ087_RS21225 (4335746) | 4335746..4336702 | + | 957 | WP_230122310.1 | GTPase | - |
LQ087_RS21230 (4336765) | 4336765..4337067 | - | 303 | WP_230122311.1 | BrnA antitoxin family protein | Antitoxin |
LQ087_RS21235 (4337054) | 4337054..4337341 | - | 288 | WP_003019170.1 | BrnT family toxin | Toxin |
LQ087_RS21240 (4337576) | 4337576..4338742 | + | 1167 | WP_230122312.1 | restriction endonuclease | - |
LQ087_RS21245 (4338838) | 4338838..4341267 | + | 2430 | WP_230122313.1 | DEAD/DEAH box helicase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11157.53 Da Isoelectric Point: 7.0746
>T295559 WP_003019170.1 NZ_OW848788:c4337341-4337054 [Citrobacter freundii]
MPMEFEWDANKAQSNLRKHGVRFEDAVLVFDDPQHLSRQDRHENGEYRWQTIGLVHGIVVILVAHSVRFESGFEVIRIIS
ARKADSKERNRYEHG
MPMEFEWDANKAQSNLRKHGVRFEDAVLVFDDPQHLSRQDRHENGEYRWQTIGLVHGIVVILVAHSVRFESGFEVIRIIS
ARKADSKERNRYEHG
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|