Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3757555..3758175 | Replicon | chromosome |
| Accession | NZ_OW848788 | ||
| Organism | Citrobacter freundii isolate 112 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | R8WYV2 |
| Locus tag | LQ087_RS18565 | Protein ID | WP_002892050.1 |
| Coordinates | 3757957..3758175 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | - |
| Locus tag | LQ087_RS18560 | Protein ID | WP_230122246.1 |
| Coordinates | 3757555..3757929 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ087_RS18550 (3752701) | 3752701..3753894 | + | 1194 | WP_003835922.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| LQ087_RS18555 (3753917) | 3753917..3757066 | + | 3150 | WP_003021736.1 | efflux RND transporter permease AcrB | - |
| LQ087_RS18560 (3757555) | 3757555..3757929 | + | 375 | WP_230122246.1 | Hha toxicity modulator TomB | Antitoxin |
| LQ087_RS18565 (3757957) | 3757957..3758175 | + | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
| LQ087_RS18570 (3758482) | 3758482..3759033 | + | 552 | WP_003835924.1 | maltose O-acetyltransferase | - |
| LQ087_RS18575 (3759150) | 3759150..3759620 | + | 471 | WP_087879033.1 | YlaC family protein | - |
| LQ087_RS18580 (3759699) | 3759699..3759839 | - | 141 | WP_005125190.1 | type B 50S ribosomal protein L36 | - |
| LQ087_RS18585 (3759841) | 3759841..3760101 | - | 261 | WP_003021719.1 | type B 50S ribosomal protein L31 | - |
| LQ087_RS18590 (3760290) | 3760290..3761843 | + | 1554 | WP_003835927.1 | EAL domain-containing protein | - |
| LQ087_RS18595 (3761895) | 3761895..3762248 | - | 354 | WP_003831033.1 | DUF1428 family protein | - |
| LQ087_RS18600 (3762313) | 3762313..3762942 | - | 630 | WP_003835929.1 | membrane protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T295558 WP_002892050.1 NZ_OW848788:3757957-3758175 [Citrobacter freundii]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14427.23 Da Isoelectric Point: 5.5653
>AT295558 WP_230122246.1 NZ_OW848788:3757555-3757929 [Citrobacter freundii]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEQSNHGWVNDPTSATSLQINELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEQSNHGWVNDPTSATSLQINELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|