Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 2527882..2528521 | Replicon | chromosome |
| Accession | NZ_OW848788 | ||
| Organism | Citrobacter freundii isolate 112 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A8B5QF36 |
| Locus tag | LQ087_RS12530 | Protein ID | WP_003020221.1 |
| Coordinates | 2527882..2528058 (+) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | LQ087_RS12535 | Protein ID | WP_123924900.1 |
| Coordinates | 2528105..2528521 (+) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ087_RS12510 (2524660) | 2524660..2524890 | - | 231 | WP_003020233.1 | DUF2554 family protein | - |
| LQ087_RS12515 (2525080) | 2525080..2525205 | - | 126 | WP_003020230.1 | DUF2474 domain-containing protein | - |
| LQ087_RS12520 (2525205) | 2525205..2526215 | - | 1011 | WP_003020227.1 | cytochrome d ubiquinol oxidase subunit II | - |
| LQ087_RS12525 (2526215) | 2526215..2527618 | - | 1404 | WP_003020224.1 | cytochrome ubiquinol oxidase subunit I | - |
| LQ087_RS12530 (2527882) | 2527882..2528058 | + | 177 | WP_003020221.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| LQ087_RS12535 (2528105) | 2528105..2528521 | + | 417 | WP_123924900.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| LQ087_RS12540 (2528614) | 2528614..2530023 | + | 1410 | WP_003836140.1 | PLP-dependent aminotransferase family protein | - |
| LQ087_RS12545 (2530351) | 2530351..2531496 | + | 1146 | WP_003020212.1 | ABC transporter substrate-binding protein | - |
| LQ087_RS12550 (2531513) | 2531513..2532529 | + | 1017 | WP_003020210.1 | ABC transporter ATP-binding protein | - |
| LQ087_RS12555 (2532530) | 2532530..2533474 | + | 945 | WP_003843727.1 | ABC transporter permease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6769.80 Da Isoelectric Point: 11.2510
>T295556 WP_003020221.1 NZ_OW848788:2527882-2528058 [Citrobacter freundii]
VKQSEFRRWLESQGVAVTNGSNHLKLRYQGRRSVMPRHPGDEIKEALRKAIIKQLDLQ
VKQSEFRRWLESQGVAVTNGSNHLKLRYQGRRSVMPRHPGDEIKEALRKAIIKQLDLQ
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15126.36 Da Isoelectric Point: 4.5716
>AT295556 WP_123924900.1 NZ_OW848788:2528105-2528521 [Citrobacter freundii]
MRYPVTLTPAVEGGFVVSFPDIPEALTQGNTRHDALQAAQAALITAFEFYFDDNEAIPLPSAVSAEDDYVEIPLSVASKV
LLLNAFLESKITQQELANRIGRPKQEITRLFDLKHTTKIDAVQIAARALGKELALTML
MRYPVTLTPAVEGGFVVSFPDIPEALTQGNTRHDALQAAQAALITAFEFYFDDNEAIPLPSAVSAEDDYVEIPLSVASKV
LLLNAFLESKITQQELANRIGRPKQEITRLFDLKHTTKIDAVQIAARALGKELALTML
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|