Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 1105069..1105723 | Replicon | chromosome |
| Accession | NZ_OW848788 | ||
| Organism | Citrobacter freundii isolate 112 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | A0A0J1NHY7 |
| Locus tag | LQ087_RS05410 | Protein ID | WP_003026936.1 |
| Coordinates | 1105069..1105476 (-) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | A0A6H3AT26 |
| Locus tag | LQ087_RS05415 | Protein ID | WP_003026938.1 |
| Coordinates | 1105457..1105723 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ087_RS05390 (1101017) | 1101017..1102750 | - | 1734 | WP_016150943.1 | single-stranded-DNA-specific exonuclease RecJ | - |
| LQ087_RS05395 (1102756) | 1102756..1103469 | - | 714 | WP_003825520.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| LQ087_RS05400 (1103493) | 1103493..1104389 | - | 897 | WP_230121762.1 | site-specific tyrosine recombinase XerD | - |
| LQ087_RS05405 (1104503) | 1104503..1105024 | + | 522 | WP_003026933.1 | flavodoxin FldB | - |
| LQ087_RS05410 (1105069) | 1105069..1105476 | - | 408 | WP_003026936.1 | protein YgfX | Toxin |
| LQ087_RS05415 (1105457) | 1105457..1105723 | - | 267 | WP_003026938.1 | FAD assembly factor SdhE | Antitoxin |
| LQ087_RS05420 (1105980) | 1105980..1106960 | + | 981 | WP_003838269.1 | tRNA-modifying protein YgfZ | - |
| LQ087_RS05425 (1107054) | 1107054..1107713 | - | 660 | WP_003838267.1 | hemolysin III family protein | - |
| LQ087_RS05430 (1107876) | 1107876..1108187 | - | 312 | WP_003026949.1 | N(4)-acetylcytidine aminohydrolase | - |
| LQ087_RS05435 (1108240) | 1108240..1108968 | + | 729 | WP_060855085.1 | MurR/RpiR family transcriptional regulator | - |
| LQ087_RS05440 (1109089) | 1109089..1110522 | + | 1434 | WP_230121763.1 | 6-phospho-beta-glucosidase BglA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 15953.89 Da Isoelectric Point: 11.4054
>T295551 WP_003026936.1 NZ_OW848788:c1105476-1105069 [Citrobacter freundii]
VVQWQSDLRVSWRAQWLSLLIHGLVAVFILLMPWPLSYTPLWLVLLSLVVFDSVRSQRRINACQGEIRLLMDGRLRWQGQ
EWSIVSAPWMVKTGMMLRLRSDAGKRQHLWLAADSMDDAEWRDLRRLMLQKAKQK
VVQWQSDLRVSWRAQWLSLLIHGLVAVFILLMPWPLSYTPLWLVLLSLVVFDSVRSQRRINACQGEIRLLMDGRLRWQGQ
EWSIVSAPWMVKTGMMLRLRSDAGKRQHLWLAADSMDDAEWRDLRRLMLQKAKQK
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0J1NHY7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A6H3AT26 |