Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 290000..290586 Replicon chromosome
Accession NZ_OW848788
Organism Citrobacter freundii isolate 112

Toxin (Protein)


Gene name doc Uniprot ID A0A0J1QS94
Locus tag LQ087_RS01400 Protein ID WP_032937237.1
Coordinates 290218..290586 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID A0A0J1N092
Locus tag LQ087_RS01395 Protein ID WP_032937236.1
Coordinates 290000..290221 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LQ087_RS01370 (285799) 285799..286725 + 927 WP_003023435.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
LQ087_RS01375 (286722) 286722..287999 + 1278 WP_032950432.1 branched chain amino acid ABC transporter permease LivM -
LQ087_RS01380 (287996) 287996..288763 + 768 WP_003023438.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
LQ087_RS01385 (288781) 288781..289494 + 714 WP_003827581.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
LQ087_RS01390 (289597) 289597..289878 + 282 WP_003023442.1 hypothetical protein -
LQ087_RS01395 (290000) 290000..290221 + 222 WP_032937236.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
LQ087_RS01400 (290218) 290218..290586 + 369 WP_032937237.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
LQ087_RS01405 (290830) 290830..292146 + 1317 WP_003837839.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
LQ087_RS01410 (292247) 292247..293134 + 888 WP_230121610.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
LQ087_RS01415 (293131) 293131..293976 + 846 WP_003023450.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
LQ087_RS01420 (293979) 293979..295049 + 1071 WP_003837845.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 286722..295789 9067


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(1-121)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13617.91 Da        Isoelectric Point: 6.9891

>T295549 WP_032937237.1 NZ_OW848788:290218-290586 [Citrobacter freundii]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEALMYRVLNQIEYEGVTDVWLLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIVLSANPDFVAMTVEAAAGQLTLEQIAHRLRH

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8306.41 Da        Isoelectric Point: 4.7906

>AT295549 WP_032937236.1 NZ_OW848788:290000-290221 [Citrobacter freundii]
MRTMNYSEARQNLAEVLESAVTGVPVTITRRGHKPAVIISAEEFERYQAARLDDEFADIMMIHGNEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0J1QS94

Antitoxin

Source ID Structure
AlphaFold DB A0A0J1N092

References