Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RHH(antitoxin)
Location 93314..93873 Replicon plasmid P1
Accession NZ_OW848786
Organism Escherichia coli isolate 131

Toxin (Protein)


Gene name relE Uniprot ID V0SVC8
Locus tag LQ117_RS25185 Protein ID WP_000421272.1
Coordinates 93314..93589 (-) Length 92 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID V0SRR3
Locus tag LQ117_RS25190 Protein ID WP_001387467.1
Coordinates 93589..93873 (-) Length 95 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LQ117_RS25150 (88488) 88488..89510 + 1023 WP_000361402.1 helicase UvrD -
LQ117_RS25160 (90495) 90495..90763 - 269 Protein_108 type II toxin-antitoxin system RelE/ParE family toxin -
LQ117_RS25165 (90750) 90750..91018 - 269 Protein_109 type II toxin-antitoxin system ParD family antitoxin -
LQ117_RS25170 (91550) 91550..92719 + 1170 WP_001072355.1 hypothetical protein -
LQ117_RS25175 (92752) 92752..92880 + 129 Protein_111 IS481 family transposase -
LQ117_RS25180 (93005) 93005..93208 - 204 Protein_112 hypothetical protein -
LQ117_RS25185 (93314) 93314..93589 - 276 WP_000421272.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
LQ117_RS25190 (93589) 93589..93873 - 285 WP_001387467.1 ribbon-helix-helix domain-containing protein Antitoxin
LQ117_RS25195 (94478) 94478..95230 + 753 WP_000562172.1 IclR family transcriptional regulator -
LQ117_RS25200 (95276) 95276..96241 - 966 WP_001022265.1 2-keto-3-deoxygluconate transporter -
LQ117_RS25205 (96274) 96274..96654 - 381 WP_000710783.1 Rid family detoxifying hydrolase -
LQ117_RS25210 (96679) 96679..97569 - 891 WP_001077068.1 dihydrodipicolinate synthase family protein -
LQ117_RS25215 (97802) 97802..97996 - 195 WP_000796505.1 hypothetical protein -
LQ117_RS25220 (97970) 97970..98410 + 441 Protein_120 zinc-binding dehydrogenase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid aac(6')-Ib-cr / blaOXA-1 - 1..109001 109001
- flank IS/Tn - - 89764..90267 503


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-90)

Antitoxin

Ribbon-helix-helix protein, CopG

(14-51)


Sequences

Toxin        


Download         Length: 92 a.a.        Molecular weight: 10749.45 Da        Isoelectric Point: 10.0871

>T295547 WP_000421272.1 NZ_OW848786:c93589-93314 [Escherichia coli]
MELKWTSKALSDLSRLFDFLVLASKPAAARTVQSLTQAPVILLTHPRMGEQLFQFEPREVRRIFAGEYEIRYEINGQTIY
VLRLWHTRENR

Download         Length: 276 bp

Antitoxin


Download         Length: 95 a.a.        Molecular weight: 10460.87 Da        Isoelectric Point: 5.6558

>AT295547 WP_001387467.1 NZ_OW848786:c93873-93589 [Escherichia coli]
MQMKNNAAQATKVITAHVPLPMADKVDQMAARLERSRGWVIKQALSAWLAQEEERNRLTLEALDDVTSGQVIDHQAVQAW
SDSLSTDNPLPVPR

Download         Length: 285 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB V0SVC8

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0Y880

References