Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 86220..86863 Replicon plasmid P1
Accession NZ_OW848786
Organism Escherichia coli isolate 131

Toxin (Protein)


Gene name vagD Uniprot ID V0UN72
Locus tag LQ117_RS25140 Protein ID WP_001034044.1
Coordinates 86447..86863 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID B1P7N7
Locus tag LQ117_RS25135 Protein ID WP_001261286.1
Coordinates 86220..86450 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LQ117_RS25120 (81357) 81357..81587 + 231 WP_001261278.1 type II toxin-antitoxin system VapB family antitoxin -
LQ117_RS25125 (81584) 81584..82000 + 417 WP_001034046.1 type II toxin-antitoxin system VapC family toxin -
LQ117_RS25130 (82045) 82045..85839 - 3795 WP_001144732.1 hypothetical protein -
LQ117_RS25135 (86220) 86220..86450 + 231 WP_001261286.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
LQ117_RS25140 (86447) 86447..86863 + 417 WP_001034044.1 type II toxin-antitoxin system VapC family toxin Toxin
LQ117_RS25145 (86938) 86938..88503 + 1566 WP_001128474.1 AAA family ATPase -
LQ117_RS25150 (88488) 88488..89510 + 1023 WP_000361402.1 helicase UvrD -
LQ117_RS25160 (90495) 90495..90763 - 269 Protein_108 type II toxin-antitoxin system RelE/ParE family toxin -
LQ117_RS25165 (90750) 90750..91018 - 269 Protein_109 type II toxin-antitoxin system ParD family antitoxin -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid aac(6')-Ib-cr / blaOXA-1 - 1..109001 109001
- flank IS/Tn - - 89764..90267 503


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-52)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15232.66 Da        Isoelectric Point: 6.8536

>T295546 WP_001034044.1 NZ_OW848786:86447-86863 [Escherichia coli]
VNKIYMLDTNICSFIMREQPEALLKHLEQSVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAACAILVTNNVREFERVPGLVLEDWVR

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8747.86 Da        Isoelectric Point: 4.3775

>AT295546 WP_001261286.1 NZ_OW848786:86220-86450 [Escherichia coli]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFLELEKADPDFMTEREDVVSDEGRVNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CHW1

Antitoxin

Source ID Structure
AlphaFold DB A0A829CKZ6

References