Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 86220..86863 | Replicon | plasmid P1 |
Accession | NZ_OW848786 | ||
Organism | Escherichia coli isolate 131 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | V0UN72 |
Locus tag | LQ117_RS25140 | Protein ID | WP_001034044.1 |
Coordinates | 86447..86863 (+) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | B1P7N7 |
Locus tag | LQ117_RS25135 | Protein ID | WP_001261286.1 |
Coordinates | 86220..86450 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LQ117_RS25120 (81357) | 81357..81587 | + | 231 | WP_001261278.1 | type II toxin-antitoxin system VapB family antitoxin | - |
LQ117_RS25125 (81584) | 81584..82000 | + | 417 | WP_001034046.1 | type II toxin-antitoxin system VapC family toxin | - |
LQ117_RS25130 (82045) | 82045..85839 | - | 3795 | WP_001144732.1 | hypothetical protein | - |
LQ117_RS25135 (86220) | 86220..86450 | + | 231 | WP_001261286.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
LQ117_RS25140 (86447) | 86447..86863 | + | 417 | WP_001034044.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
LQ117_RS25145 (86938) | 86938..88503 | + | 1566 | WP_001128474.1 | AAA family ATPase | - |
LQ117_RS25150 (88488) | 88488..89510 | + | 1023 | WP_000361402.1 | helicase UvrD | - |
LQ117_RS25160 (90495) | 90495..90763 | - | 269 | Protein_108 | type II toxin-antitoxin system RelE/ParE family toxin | - |
LQ117_RS25165 (90750) | 90750..91018 | - | 269 | Protein_109 | type II toxin-antitoxin system ParD family antitoxin | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | aac(6')-Ib-cr / blaOXA-1 | - | 1..109001 | 109001 | |
- | flank | IS/Tn | - | - | 89764..90267 | 503 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15232.66 Da Isoelectric Point: 6.8536
>T295546 WP_001034044.1 NZ_OW848786:86447-86863 [Escherichia coli]
VNKIYMLDTNICSFIMREQPEALLKHLEQSVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAACAILVTNNVREFERVPGLVLEDWVR
VNKIYMLDTNICSFIMREQPEALLKHLEQSVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAACAILVTNNVREFERVPGLVLEDWVR
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CHW1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CKZ6 |