Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 81357..82000 | Replicon | plasmid P1 |
Accession | NZ_OW848786 | ||
Organism | Escherichia coli isolate 131 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | C7S9Y5 |
Locus tag | LQ117_RS25125 | Protein ID | WP_001034046.1 |
Coordinates | 81584..82000 (+) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | V0SR71 |
Locus tag | LQ117_RS25120 | Protein ID | WP_001261278.1 |
Coordinates | 81357..81587 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LQ117_RS25095 (77179) | 77179..77604 | + | 426 | WP_000422741.1 | transposase | - |
LQ117_RS25100 (77601) | 77601..77951 | + | 351 | WP_000624722.1 | IS66 family insertion sequence element accessory protein TnpB | - |
LQ117_RS25105 (77982) | 77982..79595 | + | 1614 | WP_000080195.1 | IS66-like element ISEc23 family transposase | - |
LQ117_RS25110 (79806) | 79806..80579 | - | 774 | WP_000905949.1 | hypothetical protein | - |
LQ117_RS25115 (80592) | 80592..81092 | - | 501 | WP_000528932.1 | HEPN family nuclease | - |
LQ117_RS25120 (81357) | 81357..81587 | + | 231 | WP_001261278.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
LQ117_RS25125 (81584) | 81584..82000 | + | 417 | WP_001034046.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
LQ117_RS25130 (82045) | 82045..85839 | - | 3795 | WP_001144732.1 | hypothetical protein | - |
LQ117_RS25135 (86220) | 86220..86450 | + | 231 | WP_001261286.1 | type II toxin-antitoxin system VapB family antitoxin | - |
LQ117_RS25140 (86447) | 86447..86863 | + | 417 | WP_001034044.1 | type II toxin-antitoxin system VapC family toxin | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | aac(6')-Ib-cr / blaOXA-1 | - | 1..109001 | 109001 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 14978.31 Da Isoelectric Point: 6.7113
>T295545 WP_001034046.1 NZ_OW848786:81584-82000 [Escherichia coli]
VNKIYMLDTNICSFIMREQPEAVLKNLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCARLDAILPWDRA
AVDATTEVKVALRLAGTPIGPNDTAIAGHAIATGAILVTNNVREFERVPGLVLEDWAG
VNKIYMLDTNICSFIMREQPEAVLKNLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCARLDAILPWDRA
AVDATTEVKVALRLAGTPIGPNDTAIAGHAIATGAILVTNNVREFERVPGLVLEDWAG
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9NXF9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | V0SR71 |