Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 81357..82000 Replicon plasmid P1
Accession NZ_OW848786
Organism Escherichia coli isolate 131

Toxin (Protein)


Gene name vagD Uniprot ID C7S9Y5
Locus tag LQ117_RS25125 Protein ID WP_001034046.1
Coordinates 81584..82000 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID V0SR71
Locus tag LQ117_RS25120 Protein ID WP_001261278.1
Coordinates 81357..81587 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LQ117_RS25095 (77179) 77179..77604 + 426 WP_000422741.1 transposase -
LQ117_RS25100 (77601) 77601..77951 + 351 WP_000624722.1 IS66 family insertion sequence element accessory protein TnpB -
LQ117_RS25105 (77982) 77982..79595 + 1614 WP_000080195.1 IS66-like element ISEc23 family transposase -
LQ117_RS25110 (79806) 79806..80579 - 774 WP_000905949.1 hypothetical protein -
LQ117_RS25115 (80592) 80592..81092 - 501 WP_000528932.1 HEPN family nuclease -
LQ117_RS25120 (81357) 81357..81587 + 231 WP_001261278.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
LQ117_RS25125 (81584) 81584..82000 + 417 WP_001034046.1 type II toxin-antitoxin system VapC family toxin Toxin
LQ117_RS25130 (82045) 82045..85839 - 3795 WP_001144732.1 hypothetical protein -
LQ117_RS25135 (86220) 86220..86450 + 231 WP_001261286.1 type II toxin-antitoxin system VapB family antitoxin -
LQ117_RS25140 (86447) 86447..86863 + 417 WP_001034044.1 type II toxin-antitoxin system VapC family toxin -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid aac(6')-Ib-cr / blaOXA-1 - 1..109001 109001


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-53)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 14978.31 Da        Isoelectric Point: 6.7113

>T295545 WP_001034046.1 NZ_OW848786:81584-82000 [Escherichia coli]
VNKIYMLDTNICSFIMREQPEAVLKNLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCARLDAILPWDRA
AVDATTEVKVALRLAGTPIGPNDTAIAGHAIATGAILVTNNVREFERVPGLVLEDWAG

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8853.07 Da        Isoelectric Point: 4.6437

>AT295545 WP_001261278.1 NZ_OW848786:81357-81587 [Escherichia coli]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDRIILRPLRPSWSSFLELEKADPGFMTEREDVVCDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9NXF9

Antitoxin

Source ID Structure
AlphaFold DB V0SR71

References