Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 74349..74874 | Replicon | plasmid P1 |
| Accession | NZ_OW848786 | ||
| Organism | Escherichia coli isolate 131 | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | V0SSI5 |
| Locus tag | LQ117_RS25075 | Protein ID | WP_001159868.1 |
| Coordinates | 74349..74654 (-) | Length | 102 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | S1PPD8 |
| Locus tag | LQ117_RS25080 | Protein ID | WP_000813634.1 |
| Coordinates | 74656..74874 (-) | Length | 73 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ117_RS25060 (70313) | 70313..71479 | - | 1167 | WP_000772446.1 | plasmid-partitioning protein SopA | - |
| LQ117_RS25065 (72067) | 72067..72822 | - | 756 | WP_000852146.1 | replication initiation protein RepE | - |
| LQ117_RS25070 (73542) | 73542..74348 | - | 807 | WP_000016982.1 | site-specific integrase | - |
| LQ117_RS25075 (74349) | 74349..74654 | - | 306 | WP_001159868.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
| LQ117_RS25080 (74656) | 74656..74874 | - | 219 | WP_000813634.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
| LQ117_RS25085 (75420) | 75420..75932 | + | 513 | WP_000151784.1 | hypothetical protein | - |
| LQ117_RS25090 (75966) | 75966..77087 | - | 1122 | WP_012783980.1 | DUF3800 domain-containing protein | - |
| LQ117_RS25095 (77179) | 77179..77604 | + | 426 | WP_000422741.1 | transposase | - |
| LQ117_RS25100 (77601) | 77601..77951 | + | 351 | WP_000624722.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| LQ117_RS25105 (77982) | 77982..79595 | + | 1614 | WP_000080195.1 | IS66-like element ISEc23 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | aac(6')-Ib-cr / blaOXA-1 | - | 1..109001 | 109001 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11706.51 Da Isoelectric Point: 6.4674
>T295544 WP_001159868.1 NZ_OW848786:c74654-74349 [Escherichia coli]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|