Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 4085815..4086433 | Replicon | chromosome |
Accession | NZ_OW848785 | ||
Organism | Escherichia coli isolate 131 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | LQ117_RS19660 | Protein ID | WP_001291435.1 |
Coordinates | 4085815..4086033 (-) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | LQ117_RS19665 | Protein ID | WP_000344800.1 |
Coordinates | 4086059..4086433 (-) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LQ117_RS19625 (4081102) | 4081102..4081674 | + | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
LQ117_RS19630 (4081705) | 4081705..4082016 | - | 312 | WP_000409908.1 | MGMT family protein | - |
LQ117_RS19640 (4082395) | 4082395..4082748 | + | 354 | WP_000878135.1 | DUF1428 family protein | - |
LQ117_RS19645 (4082790) | 4082790..4084340 | - | 1551 | WP_001385227.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
LQ117_RS19650 (4084504) | 4084504..4084974 | - | 471 | WP_000136192.1 | YlaC family protein | - |
LQ117_RS19655 (4085090) | 4085090..4085641 | - | 552 | WP_000102539.1 | maltose O-acetyltransferase | - |
LQ117_RS19660 (4085815) | 4085815..4086033 | - | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
LQ117_RS19665 (4086059) | 4086059..4086433 | - | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
LQ117_RS19670 (4086979) | 4086979..4090128 | - | 3150 | WP_001132478.1 | efflux RND transporter permease AcrB | - |
LQ117_RS19675 (4090151) | 4090151..4091344 | - | 1194 | WP_001295833.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T295535 WP_001291435.1 NZ_OW848785:c4086033-4085815 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT295535 WP_000344800.1 NZ_OW848785:c4086433-4086059 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |