Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 3635002..3635522 Replicon chromosome
Accession NZ_OW848785
Organism Escherichia coli isolate 131

Toxin (Protein)


Gene name ccdB Uniprot ID A0A061KX66
Locus tag LQ117_RS17510 Protein ID WP_001160964.1
Coordinates 3635238..3635522 (+) Length 95 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID V0VEX8
Locus tag LQ117_RS17505 Protein ID WP_000125566.1
Coordinates 3635002..3635235 (+) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LQ117_RS17480 (3630075) 3630075..3630362 + 288 WP_000203744.1 ferredoxin-like protein FixX -
LQ117_RS17485 (3630421) 3630421..3631752 + 1332 WP_001183209.1 MFS transporter -
LQ117_RS17490 (3631860) 3631860..3632390 + 531 WP_000600725.1 glutathione-regulated potassium-efflux system oxidoreductase KefF -
LQ117_RS17495 (3632383) 3632383..3634245 + 1863 WP_000377106.1 glutathione-regulated potassium-efflux system protein KefC -
LQ117_RS17500 (3634437) 3634437..3634916 + 480 WP_000624375.1 type 3 dihydrofolate reductase -
LQ117_RS17505 (3635002) 3635002..3635235 + 234 WP_000125566.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
LQ117_RS17510 (3635238) 3635238..3635522 + 285 WP_001160964.1 CcdB family protein Toxin
LQ117_RS17515 (3635549) 3635549..3636397 - 849 WP_000257181.1 bis(5'-nucleosyl)-tetraphosphatase (symmetrical) ApaH -
LQ117_RS17520 (3636404) 3636404..3636781 - 378 WP_000610901.1 Co2+/Mg2+ efflux protein ApaG -
LQ117_RS17525 (3636784) 3636784..3637605 - 822 WP_001065365.1 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA -
LQ117_RS17530 (3637602) 3637602..3638591 - 990 WP_000241227.1 4-hydroxythreonine-4-phosphate dehydrogenase PdxA -
LQ117_RS17535 (3638591) 3638591..3639877 - 1287 WP_000800457.1 peptidylprolyl isomerase SurA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-93)

Antitoxin

Post-segregation antitoxin CcdA

(8-77)


Sequences

Toxin        


Download         Length: 95 a.a.        Molecular weight: 10692.54 Da        Isoelectric Point: 10.3030

>T295533 WP_001160964.1 NZ_OW848785:3635238-3635522 [Escherichia coli]
MQFTVYRSRGRNAAFPFVIDVTSDIIGEINRRIVIPLTPIERFSRIRPPERLNPILLLIDGKEYVLMTHETATVPVNALG
TKFCDASAHRTLIK

Download         Length: 285 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8530.53 Da        Isoelectric Point: 5.8062

>AT295533 WP_000125566.1 NZ_OW848785:3635002-3635235 [Escherichia coli]
MTAKRTTQSVTVTVDRELVNRARDAGLNMSATLTVALNAELKKHAATRWREENAEAIAALNQLADETGCFSDEYRSF

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A061KX66

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9LTM9

References