Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 3465299..3466134 | Replicon | chromosome |
Accession | NZ_OW848785 | ||
Organism | Escherichia coli isolate 131 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | A0A0J2AEA6 |
Locus tag | LQ117_RS16700 | Protein ID | WP_000854759.1 |
Coordinates | 3465757..3466134 (+) | Length | 126 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | S1NM52 |
Locus tag | LQ117_RS16695 | Protein ID | WP_001295723.1 |
Coordinates | 3465299..3465667 (+) | Length | 123 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LQ117_RS16670 (3462414) | 3462414..3462609 | + | 196 | Protein_3258 | DUF905 family protein | - |
LQ117_RS16675 (3462727) | 3462727..3463545 | + | 819 | WP_001234738.1 | DUF932 domain-containing protein | - |
LQ117_RS16680 (3463887) | 3463887..3464360 | + | 474 | WP_001350782.1 | antirestriction protein | - |
LQ117_RS16685 (3464376) | 3464376..3464852 | + | 477 | WP_001186775.1 | RadC family protein | - |
LQ117_RS16690 (3464915) | 3464915..3465136 | + | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
LQ117_RS16695 (3465299) | 3465299..3465667 | + | 369 | WP_001295723.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
LQ117_RS16700 (3465757) | 3465757..3466134 | + | 378 | WP_000854759.1 | TA system toxin CbtA family protein | Toxin |
LQ117_RS16705 (3466131) | 3466131..3466619 | + | 489 | WP_000761690.1 | DUF5983 family protein | - |
LQ117_RS16710 (3466636) | 3466636..3466812 | + | 177 | WP_000839286.1 | DUF957 domain-containing protein | - |
LQ117_RS16715 (3466918) | 3466918..3467067 | + | 150 | Protein_3267 | hypothetical protein | - |
LQ117_RS16720 (3467434) | 3467434..3467610 | + | 177 | Protein_3268 | helix-turn-helix domain-containing protein | - |
LQ117_RS16725 (3468401) | 3468401..3470023 | + | 1623 | WP_001295726.1 | Alw26I/Eco31I/Esp3I family type II restriction adenine-specific DNA-methyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14144.26 Da Isoelectric Point: 7.3249
>T295531 WP_000854759.1 NZ_OW848785:3465757-3466134 [Escherichia coli]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13592.40 Da Isoelectric Point: 6.6255
>AT295531 WP_001295723.1 NZ_OW848785:3465299-3465667 [Escherichia coli]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0J2AEA6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | S1NM52 |