Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 3208863..3209698 | Replicon | chromosome |
| Accession | NZ_OW848785 | ||
| Organism | Escherichia coli isolate 131 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A5F0P695 |
| Locus tag | LQ117_RS15350 | Protein ID | WP_022645116.1 |
| Coordinates | 3208863..3209240 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | S1NM52 |
| Locus tag | LQ117_RS15355 | Protein ID | WP_001295723.1 |
| Coordinates | 3209330..3209698 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ117_RS15325 (3205230) | 3205230..3206768 | - | 1539 | WP_001187191.1 | lysine decarboxylation/transport transcriptional activator CadC | - |
| LQ117_RS15330 (3207028) | 3207028..3207187 | - | 160 | Protein_2995 | integrase | - |
| LQ117_RS15335 (3207517) | 3207517..3208359 | - | 843 | WP_022645115.1 | DUF4942 domain-containing protein | - |
| LQ117_RS15340 (3208444) | 3208444..3208638 | - | 195 | WP_024181941.1 | DUF957 domain-containing protein | - |
| LQ117_RS15345 (3208717) | 3208717..3208866 | - | 150 | Protein_2998 | DUF5983 family protein | - |
| LQ117_RS15350 (3208863) | 3208863..3209240 | - | 378 | WP_022645116.1 | TA system toxin CbtA family protein | Toxin |
| LQ117_RS15355 (3209330) | 3209330..3209698 | - | 369 | WP_001295723.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| LQ117_RS15360 (3209861) | 3209861..3210082 | - | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
| LQ117_RS15365 (3210145) | 3210145..3210621 | - | 477 | WP_022645117.1 | RadC family protein | - |
| LQ117_RS15370 (3210637) | 3210637..3211116 | - | 480 | WP_001564060.1 | antirestriction protein | - |
| LQ117_RS15375 (3211382) | 3211382..3212200 | - | 819 | WP_001175165.1 | DUF932 domain-containing protein | - |
| LQ117_RS15380 (3212290) | 3212290..3212523 | - | 234 | WP_022645118.1 | DUF905 family protein | - |
| LQ117_RS15385 (3212529) | 3212529..3213206 | - | 678 | WP_001097302.1 | hypothetical protein | - |
| LQ117_RS15390 (3213354) | 3213354..3214034 | - | 681 | WP_001282921.1 | WYL domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 3181826..3243472 | 61646 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14021.99 Da Isoelectric Point: 7.8045
>T295529 WP_022645116.1 NZ_OW848785:c3209240-3208863 [Escherichia coli]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGIALCDAVNFLVEKYALVRTDQPGF
SAGTSSQLINSIDILRARRATGLMTRSNYRTVNNITRGKHPEAKQ
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGIALCDAVNFLVEKYALVRTDQPGF
SAGTSSQLINSIDILRARRATGLMTRSNYRTVNNITRGKHPEAKQ
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13592.40 Da Isoelectric Point: 6.6255
>AT295529 WP_001295723.1 NZ_OW848785:c3209698-3209330 [Escherichia coli]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5F0P695 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | S1NM52 |