295523

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 1851751..1852585 Replicon chromosome
Accession NZ_OW848785
Organism Escherichia coli isolate 131

Toxin (Protein)


Gene name yeeV Uniprot ID S1PLF5
Locus tag LQ117_RS08915 Protein ID WP_000854690.1
Coordinates 1852208..1852585 (+) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID S1P7N8
Locus tag LQ117_RS08910 Protein ID WP_001305076.1
Coordinates 1851751..1852119 (+) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LQ117_RS08870 (1846833) 1846833..1847960 + 1128 Protein_1743 hypothetical protein -
LQ117_RS08875 (1848036) 1848036..1848491 + 456 WP_000581502.1 IrmA family protein -
LQ117_RS08880 (1848570) 1848570..1848803 + 234 WP_000902034.1 DUF905 family protein -
LQ117_RS08885 (1848904) 1848904..1849722 + 819 WP_001234620.1 DUF932 domain-containing protein -
LQ117_RS08890 (1849777) 1849777..1850262 + 486 WP_000849565.1 antirestriction protein -
LQ117_RS08895 (1850278) 1850278..1850754 + 477 WP_001186726.1 RadC family protein -
LQ117_RS08900 (1850817) 1850817..1851038 + 222 WP_000692329.1 DUF987 domain-containing protein -
LQ117_RS08905 (1851057) 1851057..1851701 + 645 WP_000094916.1 hypothetical protein -
LQ117_RS08910 (1851751) 1851751..1852119 + 369 WP_001305076.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
LQ117_RS08915 (1852208) 1852208..1852585 + 378 WP_000854690.1 TA system toxin CbtA family protein Toxin
LQ117_RS08920 (1852582) 1852582..1853070 + 489 WP_000761699.1 DUF5983 family protein -
LQ117_RS08925 (1853087) 1853087..1853284 + 198 WP_000839293.1 DUF957 domain-containing protein -
LQ117_RS08930 (1853369) 1853369..1854214 + 846 WP_001529401.1 DUF4942 domain-containing protein -
LQ117_RS08935 (1854283) 1854283..1854678 + 396 WP_000208384.1 DUF6088 family protein -
LQ117_RS08940 (1854671) 1854671..1855604 + 934 Protein_1757 nucleotidyl transferase AbiEii/AbiGii toxin family protein -
LQ117_RS08945 (1856021) 1856021..1856191 + 171 Protein_1758 IS110 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - kpsF / kpsE / kpsD / kpsU / kpsC / kpsS / ugd / kpsT 1810013..1873794 63781
- flank IS/Tn - - 1856036..1856191 155


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14057.04 Da        Isoelectric Point: 9.1510

>T295523 WP_000854690.1 NZ_OW848785:1852208-1852585 [Escherichia coli]
MKTLPDTHVRAASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYAQVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKR

Download         Length: 378 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13560.39 Da        Isoelectric Point: 4.7830

>AT295523 WP_001305076.1 NZ_OW848785:1851751-1852119 [Escherichia coli]
MSDTLPGTTLPDDNKDLPWWGLPCTVTPCFGACLVQEGNRLHYLADRAGIRGRFSDADAYHPDQAFPLLMKQPELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCDYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S1PLF5

Antitoxin

Source ID Structure
AlphaFold DB S1P7N8

References