Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 1709379..1710033 | Replicon | chromosome |
Accession | NZ_OW848785 | ||
Organism | Escherichia coli isolate 131 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | F4T2L4 |
Locus tag | LQ117_RS08160 | Protein ID | WP_000244765.1 |
Coordinates | 1709379..1709786 (-) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | F4T2L5 |
Locus tag | LQ117_RS08165 | Protein ID | WP_000354050.1 |
Coordinates | 1709767..1710033 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LQ117_RS08140 (1705336) | 1705336..1707069 | - | 1734 | WP_000813195.1 | single-stranded-DNA-specific exonuclease RecJ | - |
LQ117_RS08145 (1707075) | 1707075..1707785 | - | 711 | WP_000715230.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
LQ117_RS08150 (1707810) | 1707810..1708706 | - | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
LQ117_RS08155 (1708818) | 1708818..1709339 | + | 522 | WP_001055874.1 | flavodoxin FldB | - |
LQ117_RS08160 (1709379) | 1709379..1709786 | - | 408 | WP_000244765.1 | protein YgfX | Toxin |
LQ117_RS08165 (1709767) | 1709767..1710033 | - | 267 | WP_000354050.1 | FAD assembly factor SdhE | Antitoxin |
LQ117_RS08170 (1710276) | 1710276..1711256 | + | 981 | WP_000886084.1 | tRNA-modifying protein YgfZ | - |
LQ117_RS08175 (1711333) | 1711333..1711992 | - | 660 | WP_000250275.1 | hemolysin III family protein | - |
LQ117_RS08180 (1712156) | 1712156..1712467 | - | 312 | WP_001182956.1 | N(4)-acetylcytidine aminohydrolase | - |
LQ117_RS08185 (1712512) | 1712512..1713945 | + | 1434 | WP_001296350.1 | 6-phospho-beta-glucosidase BglA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16043.95 Da Isoelectric Point: 11.5202
>T295522 WP_000244765.1 NZ_OW848785:c1709786-1709379 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLIPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLIPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A454A7D7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A061L3F4 |