Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 773277..774108 | Replicon | chromosome |
| Accession | NZ_OW848785 | ||
| Organism | Escherichia coli isolate 131 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A066T988 |
| Locus tag | LQ117_RS03935 | Protein ID | WP_000854815.1 |
| Coordinates | 773734..774108 (+) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A061Y7A8 |
| Locus tag | LQ117_RS03930 | Protein ID | WP_001280918.1 |
| Coordinates | 773277..773645 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ117_RS03885 (768366) | 768366..769112 | + | 747 | WP_001016257.1 | IS21-like element ISEc12 family helper ATPase IstB | - |
| LQ117_RS03890 (769195) | 769195..769545 | + | 351 | Protein_768 | hypothetical protein | - |
| LQ117_RS03895 (769561) | 769561..769971 | + | 411 | WP_000846703.1 | hypothetical protein | - |
| LQ117_RS03900 (770192) | 770192..771010 | + | 819 | WP_001542275.1 | DUF932 domain-containing protein | - |
| LQ117_RS03905 (771010) | 771010..771255 | + | 246 | WP_001164966.1 | hypothetical protein | - |
| LQ117_RS03910 (771349) | 771349..771822 | + | 474 | WP_001542276.1 | antirestriction protein | - |
| LQ117_RS03915 (771838) | 771838..772314 | + | 477 | WP_001186200.1 | RadC family protein | - |
| LQ117_RS03920 (772377) | 772377..772598 | + | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
| LQ117_RS03925 (772617) | 772617..773261 | + | 645 | WP_000086752.1 | hypothetical protein | - |
| LQ117_RS03930 (773277) | 773277..773645 | + | 369 | WP_001280918.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| LQ117_RS03935 (773734) | 773734..774108 | + | 375 | WP_000854815.1 | type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA | Toxin |
| LQ117_RS03940 (774105) | 774105..774299 | + | 195 | WP_000988600.1 | DUF5983 family protein | - |
| LQ117_RS03945 (774345) | 774345..774425 | + | 81 | Protein_779 | hypothetical protein | - |
| LQ117_RS03950 (774714) | 774714..774794 | - | 81 | WP_023441679.1 | hypothetical protein | - |
| LQ117_RS03955 (774914) | 774914..775066 | + | 153 | WP_050482493.1 | EutP/PduV family microcompartment system protein | - |
| LQ117_RS03960 (775148) | 775148..775573 | + | 426 | WP_000422741.1 | transposase | - |
| LQ117_RS03965 (775570) | 775570..775920 | + | 351 | WP_000624722.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| LQ117_RS03970 (775951) | 775951..777564 | + | 1614 | WP_000080195.1 | IS66-like element ISEc23 family transposase | - |
| LQ117_RS03975 (777737) | 777737..778066 | - | 330 | WP_000450409.1 | DUF496 family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13829.83 Da Isoelectric Point: 7.1326
>T295520 WP_000854815.1 NZ_OW848785:773734-774108 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTSDNYRTVNNITLGKYPEAK
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTSDNYRTVNNITLGKYPEAK
Download Length: 375 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A066T988 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A061Y7A8 |