295520

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 773277..774108 Replicon chromosome
Accession NZ_OW848785
Organism Escherichia coli isolate 131

Toxin (Protein)


Gene name yeeV Uniprot ID A0A066T988
Locus tag LQ117_RS03935 Protein ID WP_000854815.1
Coordinates 773734..774108 (+) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A061Y7A8
Locus tag LQ117_RS03930 Protein ID WP_001280918.1
Coordinates 773277..773645 (+) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LQ117_RS03885 (768366) 768366..769112 + 747 WP_001016257.1 IS21-like element ISEc12 family helper ATPase IstB -
LQ117_RS03890 (769195) 769195..769545 + 351 Protein_768 hypothetical protein -
LQ117_RS03895 (769561) 769561..769971 + 411 WP_000846703.1 hypothetical protein -
LQ117_RS03900 (770192) 770192..771010 + 819 WP_001542275.1 DUF932 domain-containing protein -
LQ117_RS03905 (771010) 771010..771255 + 246 WP_001164966.1 hypothetical protein -
LQ117_RS03910 (771349) 771349..771822 + 474 WP_001542276.1 antirestriction protein -
LQ117_RS03915 (771838) 771838..772314 + 477 WP_001186200.1 RadC family protein -
LQ117_RS03920 (772377) 772377..772598 + 222 WP_000692345.1 DUF987 domain-containing protein -
LQ117_RS03925 (772617) 772617..773261 + 645 WP_000086752.1 hypothetical protein -
LQ117_RS03930 (773277) 773277..773645 + 369 WP_001280918.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
LQ117_RS03935 (773734) 773734..774108 + 375 WP_000854815.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
LQ117_RS03940 (774105) 774105..774299 + 195 WP_000988600.1 DUF5983 family protein -
LQ117_RS03945 (774345) 774345..774425 + 81 Protein_779 hypothetical protein -
LQ117_RS03950 (774714) 774714..774794 - 81 WP_023441679.1 hypothetical protein -
LQ117_RS03955 (774914) 774914..775066 + 153 WP_050482493.1 EutP/PduV family microcompartment system protein -
LQ117_RS03960 (775148) 775148..775573 + 426 WP_000422741.1 transposase -
LQ117_RS03965 (775570) 775570..775920 + 351 WP_000624722.1 IS66 family insertion sequence element accessory protein TnpB -
LQ117_RS03970 (775951) 775951..777564 + 1614 WP_000080195.1 IS66-like element ISEc23 family transposase -
LQ117_RS03975 (777737) 777737..778066 - 330 WP_000450409.1 DUF496 family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(19-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13829.83 Da        Isoelectric Point: 7.1326

>T295520 WP_000854815.1 NZ_OW848785:773734-774108 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTSDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13811.70 Da        Isoelectric Point: 6.4767

>AT295520 WP_001280918.1 NZ_OW848785:773277-773645 [Escherichia coli]
VSDKLHETNYPDDHNDRLWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A066T988

Antitoxin

Source ID Structure
AlphaFold DB A0A061Y7A8

References