Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/LOTUS_5_Limkain_b1(toxin)
Location 1169349..1169965 Replicon chromosome
Accession NZ_OW707734
Organism Salmonella enterica subsp. enterica serovar Typhi strain BRD948

Toxin (Protein)


Gene name vapC Uniprot ID Q8Z2U3
Locus tag NBX04_RS05605 Protein ID WP_000238494.1
Coordinates 1169591..1169965 (+) Length 125 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID A0A8E9YHE9
Locus tag NBX04_RS05600 Protein ID WP_001523745.1
Coordinates 1169349..1169591 (+) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NBX04_RS05565 1164475..1165074 + 600 WP_000965695.1 glucose-1-phosphatase -
NBX04_RS05570 1165068..1165940 + 873 WP_000921423.1 virulence factor BrkB family protein -
NBX04_RS05575 1165937..1166374 + 438 WP_000560975.1 D-aminoacyl-tRNA deacylase -
NBX04_RS05580 1166419..1167360 + 942 WP_001518251.1 fatty acid biosynthesis protein FabY -
NBX04_RS05585 1167375..1167821 - 447 WP_001259009.1 type II toxin-antitoxin system HigA family antitoxin -
NBX04_RS05590 1167818..1168129 - 312 WP_000558160.1 type II toxin-antitoxin system HigB family toxin -
NBX04_RS05595 1168215..1169144 - 930 WP_001162859.1 alpha/beta hydrolase -
NBX04_RS05600 1169349..1169591 + 243 WP_001523745.1 CopG family transcriptional regulator Antitoxin
NBX04_RS05605 1169591..1169965 + 375 WP_000238494.1 type II toxin-antitoxin system VapC family toxin Toxin
NBX04_RS05610 1170003..1170932 - 930 WP_000027727.1 formate dehydrogenase accessory protein FdhE -
NBX04_RS05615 1170929..1171564 - 636 WP_000829025.1 formate dehydrogenase cytochrome b556 subunit -
NBX04_RS05620 1171561..1172463 - 903 WP_000331359.1 formate dehydrogenase subunit beta -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(7-115)

Antitoxin

Ribbon-helix-helix protein, CopG

(13-47)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13908.18 Da        Isoelectric Point: 7.3567

>T295505 WP_000238494.1 NZ_OW707734:1169591-1169965 [Salmonella enterica subsp. enterica serovar Typhi]
MVKGSALFDTNILIDLFSGRIEAKHALEAYPPQNAISLITWMEVMVGAKKYHQENRTRIALSAFNIIGVTQEIAERSVIV
RQEYGMKLPDAIILATAQVHRCELVTRNTKDFADIPGVITPYHL

Download         Length: 375 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 9437.77 Da        Isoelectric Point: 4.4463

>AT295505 WP_001523745.1 NZ_OW707734:1169349-1169591 [Salmonella enterica subsp. enterica serovar Typhi]
MMAGMDMGRILLDLSDDVIKRLDDLKVQRNLPRAELLREAVEQYLERQDRAETTISKALGLWQGCEEDGVEYQRKLREEW

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5I6CND8

Antitoxin

Source ID Structure

References