Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 4564640..4565156 | Replicon | chromosome |
| Accession | NZ_OW706648 | ||
| Organism | Salmonella enterica subsp. enterica serovar Typhi strain BRD948 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | C0Q7A9 |
| Locus tag | NBW98_RS22485 | Protein ID | WP_000220578.1 |
| Coordinates | 4564872..4565156 (+) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | V7ISI8 |
| Locus tag | NBW98_RS22480 | Protein ID | WP_000212724.1 |
| Coordinates | 4564640..4564882 (+) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NBW98_RS22460 | 4559660..4560793 | + | 1134 | WP_000459938.1 | amidohydrolase/deacetylase family metallohydrolase | - |
| NBW98_RS22465 | 4560777..4561895 | + | 1119 | WP_001139189.1 | DgaE family pyridoxal phosphate-dependent ammonia lyase | - |
| NBW98_RS22470 | 4561892..4562632 | + | 741 | WP_000779260.1 | KDGP aldolase family protein | - |
| NBW98_RS22475 | 4562649..4564562 | + | 1914 | WP_250279043.1 | BglG family transcription antiterminator | - |
| NBW98_RS22480 | 4564640..4564882 | + | 243 | WP_000212724.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| NBW98_RS22485 | 4564872..4565156 | + | 285 | WP_000220578.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NBW98_RS22490 | 4565160..4565624 | - | 465 | WP_001268860.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| NBW98_RS22495 | 4565745..4567883 | - | 2139 | WP_000187820.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| NBW98_RS22500 | 4568292..4569944 | - | 1653 | WP_000155051.1 | alpha,alpha-phosphotrehalase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10854.67 Da Isoelectric Point: 10.0482
>T295497 WP_000220578.1 NZ_OW706648:4564872-4565156 [Salmonella enterica subsp. enterica serovar Typhi]
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDANKRL
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3Z1E876 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5H5JRI5 |