Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 4325912..4326693 | Replicon | chromosome |
Accession | NZ_OW706648 | ||
Organism | Salmonella enterica subsp. enterica serovar Typhi strain BRD948 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | Q8Z1M4 |
Locus tag | NBW98_RS21165 | Protein ID | WP_000626103.1 |
Coordinates | 4326202..4326693 (+) | Length | 164 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | Q8Z1M5 |
Locus tag | NBW98_RS21160 | Protein ID | WP_001110456.1 |
Coordinates | 4325912..4326205 (+) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NBW98_RS21130 | 4322165..4323070 | + | 906 | WP_001268195.1 | YjiK family protein | - |
NBW98_RS21135 | 4323357..4323701 | - | 345 | WP_100680417.1 | Ig-like domain-containing protein | - |
NBW98_RS21140 | 4323709..4323925 | - | 217 | Protein_4123 | hypothetical protein | - |
NBW98_RS21145 | 4323948..4324235 | - | 288 | WP_001269916.1 | transcriptional regulator RtsB | - |
NBW98_RS21150 | 4324232..4325107 | - | 876 | WP_000921674.1 | AraC family transcriptional regulator | - |
NBW98_RS21155 | 4325373..4325595 | - | 223 | Protein_4126 | hypothetical protein | - |
NBW98_RS21160 | 4325912..4326205 | + | 294 | WP_001110456.1 | DUF1778 domain-containing protein | Antitoxin |
NBW98_RS21165 | 4326202..4326693 | + | 492 | WP_000626103.1 | GNAT family N-acetyltransferase | Toxin |
NBW98_RS21170 | 4326934..4327686 | - | 753 | WP_001785756.1 | non-specific acid phosphatase | - |
NBW98_RS21175 | 4327786..4327863 | - | 78 | Protein_4130 | porin family protein | - |
NBW98_RS21180 | 4328243..4328317 | + | 75 | Protein_4131 | helix-turn-helix domain-containing protein | - |
NBW98_RS21185 | 4328531..4329565 | + | 1035 | WP_001195363.1 | ParA family protein | - |
NBW98_RS21190 | 4329562..4330926 | + | 1365 | WP_000018529.1 | SPI-7-type island replicative DNA helicase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | sopE2 / vexE / vexD / vexC / vexB / vexA / tviE / tviD / tviC / tviB | 4186358..4450572 | 264214 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 164 a.a. Molecular weight: 17675.47 Da Isoelectric Point: 7.2652
>T295495 WP_000626103.1 NZ_OW706648:4326202-4326693 [Salmonella enterica subsp. enterica serovar Typhi]
MISTPEPLHAGHILTPFCCGVDSIDNWLKQRAMKNQTTGASRTFVCCGSDSNVLAYYSLASSAVTTNTSPGRFRRNMPDP
IPVVVLGRLAVDKSLHGQGVARALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQWVGFVPSPMDPMMLMVTLGDLV
ESV
MISTPEPLHAGHILTPFCCGVDSIDNWLKQRAMKNQTTGASRTFVCCGSDSNVLAYYSLASSAVTTNTSPGRFRRNMPDP
IPVVVLGRLAVDKSLHGQGVARALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQWVGFVPSPMDPMMLMVTLGDLV
ESV
Download Length: 492 bp
Antitoxin
Download Length: 98 a.a. Molecular weight: 11005.67 Da Isoelectric Point: 8.6141
>AT295495 WP_001110456.1 NZ_OW706648:4325912-4326205 [Salmonella enterica subsp. enterica serovar Typhi]
MPAANSMAMKRETLNLRIKPAERDLIDRAAKARGKNRTDFVLEAARAAAEEVLIEQRIIMADPEAYQEFLVRLDQTPSPN
AALRKTMQTPAPWEQEK
MPAANSMAMKRETLNLRIKPAERDLIDRAAKARGKNRTDFVLEAARAAAEEVLIEQRIIMADPEAYQEFLVRLDQTPSPN
AALRKTMQTPAPWEQEK
Download Length: 294 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A718CB38 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A716NSU2 |