Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 2988291..2988939 | Replicon | chromosome |
Accession | NZ_OW706648 | ||
Organism | Salmonella enterica subsp. enterica serovar Typhi strain BRD948 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | A0A715BCB4 |
Locus tag | NBW98_RS14760 | Protein ID | WP_000244762.1 |
Coordinates | 2988291..2988692 (-) | Length | 134 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S5MU13 |
Locus tag | NBW98_RS14765 | Protein ID | WP_000351186.1 |
Coordinates | 2988673..2988939 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NBW98_RS14740 | 2984220..2985953 | - | 1734 | WP_000813396.1 | single-stranded-DNA-specific exonuclease RecJ | - |
NBW98_RS14745 | 2985959..2986672 | - | 714 | WP_000745614.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
NBW98_RS14750 | 2986696..2987592 | - | 897 | WP_000434302.1 | site-specific tyrosine recombinase XerD | - |
NBW98_RS14755 | 2987705..2988226 | + | 522 | WP_001055885.1 | flavodoxin FldB | - |
NBW98_RS14760 | 2988291..2988692 | - | 402 | WP_000244762.1 | protein YgfX | Toxin |
NBW98_RS14765 | 2988673..2988939 | - | 267 | WP_000351186.1 | FAD assembly factor SdhE | Antitoxin |
NBW98_RS14770 | 2989189..2990169 | + | 981 | WP_000874170.1 | tRNA-modifying protein YgfZ | - |
NBW98_RS14775 | 2990285..2990944 | - | 660 | WP_000250289.1 | hemolysin III family protein | - |
NBW98_RS14780 | 2991108..2991419 | - | 312 | WP_001182971.1 | N(4)-acetylcytidine aminohydrolase | - |
NBW98_RS14785 | 2991578..2993011 | + | 1434 | WP_001230148.1 | 6-phospho-beta-glucosidase BglA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 134 a.a. Molecular weight: 15773.75 Da Isoelectric Point: 10.7537
>T295491 WP_000244762.1 NZ_OW706648:c2988692-2988291 [Salmonella enterica subsp. enterica serovar Typhi]
VVLWQSDLRVSWRAQWISLLLHGLVAAVILLMPWPLSYTPLWMILLSLVVFDCVRSQRRINTCQGEIKLLMDGRLRWQGQ
DWTLLRPPWLLKSGMVLRLRAESGRHQHLWLAADSMEEAEWRELRRILLQQPI
VVLWQSDLRVSWRAQWISLLLHGLVAAVILLMPWPLSYTPLWMILLSLVVFDCVRSQRRINTCQGEIKLLMDGRLRWQGQ
DWTLLRPPWLLKSGMVLRLRAESGRHQHLWLAADSMEEAEWRELRRILLQQPI
Download Length: 402 bp
Antitoxin
Download Length: 89 a.a. Molecular weight: 10550.05 Da Isoelectric Point: 6.0783
>AT295491 WP_000351186.1 NZ_OW706648:c2988939-2988673 [Salmonella enterica subsp. enterica serovar Typhi]
MDIHNKARIHWACRRGMRELDISIMPFFEHEYDSLSDEEKRIFVRLLQSDDPDLFNWLMNHGKPADAELEQMVRLIQTRN
RERGPVAI
MDIHNKARIHWACRRGMRELDISIMPFFEHEYDSLSDEEKRIFVRLLQSDDPDLFNWLMNHGKPADAELEQMVRLIQTRN
RERGPVAI
Download Length: 267 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A715BCB4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I0YWH4 |