Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 2393741..2394361 | Replicon | chromosome |
Accession | NZ_OW706648 | ||
Organism | Salmonella enterica subsp. enterica serovar Typhi strain BRD948 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | V1H8E6 |
Locus tag | NBW98_RS11880 | Protein ID | WP_001280991.1 |
Coordinates | 2394143..2394361 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | V1H4V6 |
Locus tag | NBW98_RS11875 | Protein ID | WP_000344807.1 |
Coordinates | 2393741..2394115 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NBW98_RS11865 | 2388880..2390073 | + | 1194 | WP_001039199.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
NBW98_RS11870 | 2390096..2393245 | + | 3150 | WP_001132507.1 | efflux RND transporter permease AcrB | - |
NBW98_RS11875 | 2393741..2394115 | + | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
NBW98_RS11880 | 2394143..2394361 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
NBW98_RS11885 | 2394540..2395091 | + | 552 | WP_001278793.1 | maltose O-acetyltransferase | - |
NBW98_RS11890 | 2395209..2395679 | + | 471 | WP_000136183.1 | YlaC family protein | - |
NBW98_RS11895 | 2395735..2395875 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
NBW98_RS11900 | 2395881..2396141 | - | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
NBW98_RS11905 | 2396366..2397916 | + | 1551 | WP_000213129.1 | EAL domain-containing protein | - |
NBW98_RS11915 | 2398147..2398536 | + | 390 | WP_000961285.1 | MGMT family protein | - |
NBW98_RS11920 | 2398569..2399138 | - | 570 | WP_000779802.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T295488 WP_001280991.1 NZ_OW706648:2394143-2394361 [Salmonella enterica subsp. enterica serovar Typhi]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT295488 WP_000344807.1 NZ_OW706648:2393741-2394115 [Salmonella enterica subsp. enterica serovar Typhi]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|