Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 3936363..3936879 | Replicon | chromosome |
Accession | NZ_OW706512 | ||
Organism | Salmonella enterica subsp. enterica serovar Typhi strain BRD948 |
Toxin (Protein)
Gene name | relE | Uniprot ID | C0Q7A9 |
Locus tag | NBW89_RS19680 | Protein ID | WP_000220578.1 |
Coordinates | 3936595..3936879 (+) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | V7ISI8 |
Locus tag | NBW89_RS19675 | Protein ID | WP_000212724.1 |
Coordinates | 3936363..3936605 (+) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NBW89_RS19655 | 3931383..3932516 | + | 1134 | WP_000459938.1 | amidohydrolase/deacetylase family metallohydrolase | - |
NBW89_RS19660 | 3932500..3933618 | + | 1119 | WP_001139189.1 | DgaE family pyridoxal phosphate-dependent ammonia lyase | - |
NBW89_RS19665 | 3933615..3934355 | + | 741 | WP_000779260.1 | KDGP aldolase family protein | - |
NBW89_RS19670 | 3934372..3936285 | + | 1914 | WP_250279043.1 | BglG family transcription antiterminator | - |
NBW89_RS19675 | 3936363..3936605 | + | 243 | WP_000212724.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
NBW89_RS19680 | 3936595..3936879 | + | 285 | WP_000220578.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NBW89_RS19685 | 3936883..3937347 | - | 465 | WP_001268860.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
NBW89_RS19690 | 3937468..3939606 | - | 2139 | WP_000187820.1 | anaerobic ribonucleoside-triphosphate reductase | - |
NBW89_RS19695 | 3940015..3941667 | - | 1653 | WP_000155051.1 | alpha,alpha-phosphotrehalase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10854.67 Da Isoelectric Point: 10.0482
>T295482 WP_000220578.1 NZ_OW706512:3936595-3936879 [Salmonella enterica subsp. enterica serovar Typhi]
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDANKRL
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3Z1E876 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5H5JRI5 |