Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/LOTUS_5_Limkain_b1(toxin)
Location 2994703..2995319 Replicon chromosome
Accession NZ_OW706512
Organism Salmonella enterica subsp. enterica serovar Typhi strain BRD948

Toxin (Protein)


Gene name vapC Uniprot ID Q8Z2U3
Locus tag NBW89_RS15145 Protein ID WP_000238494.1
Coordinates 2994703..2995077 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID A0A8E9YHE9
Locus tag NBW89_RS15150 Protein ID WP_001523745.1
Coordinates 2995077..2995319 (-) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NBW89_RS15130 2992205..2993107 + 903 WP_000331359.1 formate dehydrogenase subunit beta -
NBW89_RS15135 2993104..2993739 + 636 WP_000829025.1 formate dehydrogenase cytochrome b556 subunit -
NBW89_RS15140 2993736..2994665 + 930 WP_000027727.1 formate dehydrogenase accessory protein FdhE -
NBW89_RS15145 2994703..2995077 - 375 WP_000238494.1 type II toxin-antitoxin system VapC family toxin Toxin
NBW89_RS15150 2995077..2995319 - 243 WP_001523745.1 CopG family transcriptional regulator Antitoxin
NBW89_RS15155 2995524..2996453 + 930 WP_001162859.1 alpha/beta hydrolase -
NBW89_RS15160 2996539..2996850 + 312 WP_000558160.1 type II toxin-antitoxin system HigB family toxin -
NBW89_RS15165 2996847..2997293 + 447 WP_001259009.1 type II toxin-antitoxin system HigA family antitoxin -
NBW89_RS15170 2997308..2998249 - 942 WP_001518251.1 fatty acid biosynthesis protein FabY -
NBW89_RS15175 2998294..2998731 - 438 WP_000560975.1 D-aminoacyl-tRNA deacylase -
NBW89_RS15180 2998728..2999600 - 873 WP_000921423.1 virulence factor BrkB family protein -
NBW89_RS15185 2999594..3000193 - 600 WP_000965695.1 glucose-1-phosphatase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(7-115)

Antitoxin

Ribbon-helix-helix protein, CopG

(13-47)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13908.18 Da        Isoelectric Point: 7.3567

>T295477 WP_000238494.1 NZ_OW706512:c2995077-2994703 [Salmonella enterica subsp. enterica serovar Typhi]
MVKGSALFDTNILIDLFSGRIEAKHALEAYPPQNAISLITWMEVMVGAKKYHQENRTRIALSAFNIIGVTQEIAERSVIV
RQEYGMKLPDAIILATAQVHRCELVTRNTKDFADIPGVITPYHL

Download         Length: 375 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 9437.77 Da        Isoelectric Point: 4.4463

>AT295477 WP_001523745.1 NZ_OW706512:c2995319-2995077 [Salmonella enterica subsp. enterica serovar Typhi]
MMAGMDMGRILLDLSDDVIKRLDDLKVQRNLPRAELLREAVEQYLERQDRAETTISKALGLWQGCEEDGVEYQRKLREEW

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5I6CND8

Antitoxin

Source ID Structure

References