Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 1765441..1766061 | Replicon | chromosome |
| Accession | NZ_OW706512 | ||
| Organism | Salmonella enterica subsp. enterica serovar Typhi strain BRD948 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | V1H8E6 |
| Locus tag | NBW89_RS09070 | Protein ID | WP_001280991.1 |
| Coordinates | 1765843..1766061 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | V1H4V6 |
| Locus tag | NBW89_RS09065 | Protein ID | WP_000344807.1 |
| Coordinates | 1765441..1765815 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NBW89_RS09055 | 1760580..1761773 | + | 1194 | WP_001039199.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| NBW89_RS09060 | 1761796..1764945 | + | 3150 | WP_001132507.1 | efflux RND transporter permease AcrB | - |
| NBW89_RS09065 | 1765441..1765815 | + | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
| NBW89_RS09070 | 1765843..1766061 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
| NBW89_RS09075 | 1766240..1766791 | + | 552 | WP_001278793.1 | maltose O-acetyltransferase | - |
| NBW89_RS09080 | 1766909..1767379 | + | 471 | WP_000136183.1 | YlaC family protein | - |
| NBW89_RS09085 | 1767435..1767575 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
| NBW89_RS09090 | 1767581..1767841 | - | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
| NBW89_RS09095 | 1768066..1769616 | + | 1551 | WP_000213129.1 | EAL domain-containing protein | - |
| NBW89_RS09105 | 1769847..1770236 | + | 390 | WP_000961285.1 | MGMT family protein | - |
| NBW89_RS09110 | 1770269..1770838 | - | 570 | WP_000779802.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T295473 WP_001280991.1 NZ_OW706512:1765843-1766061 [Salmonella enterica subsp. enterica serovar Typhi]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT295473 WP_000344807.1 NZ_OW706512:1765441-1765815 [Salmonella enterica subsp. enterica serovar Typhi]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|