Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 4542383..4543003 | Replicon | chromosome |
| Accession | NZ_OW704627 | ||
| Organism | Salmonella enterica subsp. enterica serovar Typhi strain BRD948 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | V1H8E6 |
| Locus tag | NBW95_RS22310 | Protein ID | WP_001280991.1 |
| Coordinates | 4542785..4543003 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | V1H4V6 |
| Locus tag | NBW95_RS22305 | Protein ID | WP_000344807.1 |
| Coordinates | 4542383..4542757 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NBW95_RS22295 | 4537522..4538715 | + | 1194 | WP_001039199.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| NBW95_RS22300 | 4538738..4541887 | + | 3150 | WP_001132507.1 | efflux RND transporter permease AcrB | - |
| NBW95_RS22305 | 4542383..4542757 | + | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
| NBW95_RS22310 | 4542785..4543003 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
| NBW95_RS22315 | 4543182..4543733 | + | 552 | WP_001278793.1 | maltose O-acetyltransferase | - |
| NBW95_RS22320 | 4543851..4544321 | + | 471 | WP_000136183.1 | YlaC family protein | - |
| NBW95_RS22325 | 4544377..4544517 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
| NBW95_RS22330 | 4544523..4544783 | - | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
| NBW95_RS22335 | 4545008..4546558 | + | 1551 | WP_000213129.1 | EAL domain-containing protein | - |
| NBW95_RS22345 | 4546789..4547178 | + | 390 | WP_000961285.1 | MGMT family protein | - |
| NBW95_RS22350 | 4547211..4547780 | - | 570 | WP_000779802.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T295468 WP_001280991.1 NZ_OW704627:4542785-4543003 [Salmonella enterica subsp. enterica serovar Typhi]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT295468 WP_000344807.1 NZ_OW704627:4542383-4542757 [Salmonella enterica subsp. enterica serovar Typhi]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|