Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 1937226..1937742 | Replicon | chromosome |
Accession | NZ_OW704627 | ||
Organism | Salmonella enterica subsp. enterica serovar Typhi strain BRD948 |
Toxin (Protein)
Gene name | relE | Uniprot ID | C0Q7A9 |
Locus tag | NBW95_RS09460 | Protein ID | WP_000220578.1 |
Coordinates | 1937458..1937742 (+) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | V7ISI8 |
Locus tag | NBW95_RS09455 | Protein ID | WP_000212724.1 |
Coordinates | 1937226..1937468 (+) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NBW95_RS09435 | 1932246..1933379 | + | 1134 | WP_000459938.1 | amidohydrolase/deacetylase family metallohydrolase | - |
NBW95_RS09440 | 1933363..1934481 | + | 1119 | WP_001139189.1 | DgaE family pyridoxal phosphate-dependent ammonia lyase | - |
NBW95_RS09445 | 1934478..1935218 | + | 741 | WP_000779260.1 | KDGP aldolase family protein | - |
NBW95_RS09450 | 1935235..1937148 | + | 1914 | WP_250279043.1 | BglG family transcription antiterminator | - |
NBW95_RS09455 | 1937226..1937468 | + | 243 | WP_000212724.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
NBW95_RS09460 | 1937458..1937742 | + | 285 | WP_000220578.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NBW95_RS09465 | 1937746..1938210 | - | 465 | WP_001268860.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
NBW95_RS09470 | 1938331..1940469 | - | 2139 | WP_000187820.1 | anaerobic ribonucleoside-triphosphate reductase | - |
NBW95_RS09475 | 1940878..1942530 | - | 1653 | WP_000155051.1 | alpha,alpha-phosphotrehalase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10854.67 Da Isoelectric Point: 10.0482
>T295462 WP_000220578.1 NZ_OW704627:1937458-1937742 [Salmonella enterica subsp. enterica serovar Typhi]
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDANKRL
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3Z1E876 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5H5JRI5 |