Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 4282749..4283374 | Replicon | chromosome |
| Accession | NZ_OW704291 | ||
| Organism | Salmonella enterica subsp. enterica serovar Typhi strain BRD948 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | NBX00_RS20935 | Protein ID | WP_000911334.1 |
| Coordinates | 4282749..4283147 (-) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | M7S3S8 |
| Locus tag | NBX00_RS20940 | Protein ID | WP_000557549.1 |
| Coordinates | 4283147..4283374 (-) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NBX00_RS20920 | 4279427..4280008 | - | 582 | WP_001244646.1 | fimbrial protein | - |
| NBX00_RS20925 | 4280727..4281359 | - | 633 | WP_000835268.1 | YfdX family protein | - |
| NBX00_RS20930 | 4281406..4281942 | - | 537 | WP_001038500.1 | STM3031 family outer membrane protein | - |
| NBX00_RS20935 | 4282749..4283147 | - | 399 | WP_000911334.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
| NBX00_RS20940 | 4283147..4283374 | - | 228 | WP_000557549.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
| NBX00_RS20945 | 4283551..4283802 | + | 252 | WP_001540858.1 | hypothetical protein | - |
| NBX00_RS20950 | 4284077..4284883 | + | 807 | WP_077905073.1 | DUF1460 domain-containing protein | - |
| NBX00_RS20955 | 4285516..4286637 | - | 1122 | WP_000028980.1 | hypothetical protein | - |
| NBX00_RS20960 | 4286739..4287194 | - | 456 | WP_223229661.1 | hypothetical protein | - |
| NBX00_RS20965 | 4287277..4287480 | - | 204 | WP_000184036.1 | hypothetical protein | - |
| NBX00_RS20970 | 4287484..4288203 | - | 720 | WP_000082599.1 | Rha family transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 4273559..4290455 | 16896 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15091.44 Da Isoelectric Point: 7.7785
>T295452 WP_000911334.1 NZ_OW704291:c4283147-4282749 [Salmonella enterica subsp. enterica serovar Typhi]
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKSLAPERNFAVVEGFISRLEVLDYDTQAAIHT
GQIRTELARKGTPVGSYDQMIAGHARSRGLVVVTNNLREFERIPGIRIEDWC
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKSLAPERNFAVVEGFISRLEVLDYDTQAAIHT
GQIRTELARKGTPVGSYDQMIAGHARSRGLVVVTNNLREFERIPGIRIEDWC
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|