Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/LOTUS_5_Limkain_b1(toxin)
Location 150235..150851 Replicon chromosome
Accession NZ_OW704291
Organism Salmonella enterica subsp. enterica serovar Typhi strain BRD948

Toxin (Protein)


Gene name vapC Uniprot ID Q8Z2U3
Locus tag NBX00_RS00700 Protein ID WP_000238494.1
Coordinates 150235..150609 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID A0A8E9YHE9
Locus tag NBX00_RS00705 Protein ID WP_001523745.1
Coordinates 150609..150851 (-) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NBX00_RS00685 147737..148639 + 903 WP_000331359.1 formate dehydrogenase subunit beta -
NBX00_RS00690 148636..149271 + 636 WP_000829025.1 formate dehydrogenase cytochrome b556 subunit -
NBX00_RS00695 149268..150197 + 930 WP_000027727.1 formate dehydrogenase accessory protein FdhE -
NBX00_RS00700 150235..150609 - 375 WP_000238494.1 type II toxin-antitoxin system VapC family toxin Toxin
NBX00_RS00705 150609..150851 - 243 WP_001523745.1 CopG family transcriptional regulator Antitoxin
NBX00_RS00710 151056..151985 + 930 WP_001162859.1 alpha/beta hydrolase -
NBX00_RS00715 152071..152382 + 312 WP_000558160.1 type II toxin-antitoxin system HigB family toxin -
NBX00_RS00720 152379..152825 + 447 WP_001259009.1 type II toxin-antitoxin system HigA family antitoxin -
NBX00_RS00725 152840..153781 - 942 WP_001518251.1 fatty acid biosynthesis protein FabY -
NBX00_RS00730 153826..154263 - 438 WP_000560975.1 D-aminoacyl-tRNA deacylase -
NBX00_RS00735 154260..155132 - 873 WP_000921423.1 virulence factor BrkB family protein -
NBX00_RS00740 155126..155725 - 600 WP_000965695.1 glucose-1-phosphatase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(7-115)

Antitoxin

Ribbon-helix-helix protein, CopG

(13-47)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13908.18 Da        Isoelectric Point: 7.3567

>T295439 WP_000238494.1 NZ_OW704291:c150609-150235 [Salmonella enterica subsp. enterica serovar Typhi]
MVKGSALFDTNILIDLFSGRIEAKHALEAYPPQNAISLITWMEVMVGAKKYHQENRTRIALSAFNIIGVTQEIAERSVIV
RQEYGMKLPDAIILATAQVHRCELVTRNTKDFADIPGVITPYHL

Download         Length: 375 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 9437.77 Da        Isoelectric Point: 4.4463

>AT295439 WP_001523745.1 NZ_OW704291:c150851-150609 [Salmonella enterica subsp. enterica serovar Typhi]
MMAGMDMGRILLDLSDDVIKRLDDLKVQRNLPRAELLREAVEQYLERQDRAETTISKALGLWQGCEEDGVEYQRKLREEW

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5I6CND8

Antitoxin

Source ID Structure

References