Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relE-pasA/RelE(toxin) |
Location | 2063427..2063820 | Replicon | chromosome |
Accession | NZ_OW703833 | ||
Organism | Bifidobacterium longum subsp. infantis isolate hadza_2261_Bf14 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | NBW67_RS09300 | Protein ID | WP_229773994.1 |
Coordinates | 2063427..2063654 (-) | Length | 76 a.a. |
Antitoxin (Protein)
Gene name | pasA | Uniprot ID | - |
Locus tag | NBW67_RS09305 | Protein ID | WP_250235557.1 |
Coordinates | 2063680..2063820 (-) | Length | 47 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NBW67_RS09285 | 2060762..2061484 | - | 723 | WP_250235559.1 | hypothetical protein | - |
NBW67_RS09290 | 2061549..2062505 | - | 957 | WP_071478049.1 | A/G-specific adenine glycosylase | - |
NBW67_RS09295 | 2062526..2063188 | + | 663 | WP_003828427.1 | tRNA (cytidine(34)-2'-O)-methyltransferase | - |
NBW67_RS09300 | 2063427..2063654 | - | 228 | WP_229773994.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NBW67_RS09305 | 2063680..2063820 | - | 141 | WP_250235557.1 | hypothetical protein | Antitoxin |
NBW67_RS09310 | 2064499..2065212 | - | 714 | WP_250235555.1 | 4'-phosphopantetheinyl transferase superfamily protein | - |
NBW67_RS09315 | 2065223..2066548 | - | 1326 | WP_250236756.1 | MFS transporter | - |
NBW67_RS09320 | 2066575..2067762 | - | 1188 | WP_174774172.1 | carboxylate--amine ligase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 76 a.a. Molecular weight: 8653.22 Da Isoelectric Point: 10.1818
>T295438 WP_229773994.1 NZ_OW703833:c2063654-2063427 [Bifidobacterium longum subsp. infantis]
MKKLDRNVAKRIIAKLREISQLEDPRSTGKALAGNLAGLWRYRVGDYRIVCDIEDEVLLILVIDVAHRSKVYKRC
MKKLDRNVAKRIIAKLREISQLEDPRSTGKALAGNLAGLWRYRVGDYRIVCDIEDEVLLILVIDVAHRSKVYKRC
Download Length: 228 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|