Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PemK-RelB |
Location | 1665709..1666264 | Replicon | chromosome |
Accession | NZ_OW703833 | ||
Organism | Bifidobacterium longum subsp. infantis isolate hadza_2261_Bf14 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | NBW67_RS07595 | Protein ID | WP_250235216.1 |
Coordinates | 1665941..1666264 (+) | Length | 108 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | - |
Locus tag | NBW67_RS07590 | Protein ID | WP_250235214.1 |
Coordinates | 1665709..1665954 (+) | Length | 82 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NBW67_RS07565 | 1660899..1661084 | - | 186 | WP_162859245.1 | hypothetical protein | - |
NBW67_RS07570 | 1661523..1662209 | + | 687 | WP_250235212.1 | TetR/AcrR family transcriptional regulator | - |
NBW67_RS07575 | 1662366..1663637 | + | 1272 | WP_143723277.1 | MFS transporter | - |
NBW67_RS07580 | 1663821..1664012 | - | 192 | WP_143723276.1 | XRE family transcriptional regulator | - |
NBW67_RS07585 | 1664279..1665535 | - | 1257 | WP_106642259.1 | HipA domain-containing protein | - |
NBW67_RS07590 | 1665709..1665954 | + | 246 | WP_250235214.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
NBW67_RS07595 | 1665941..1666264 | + | 324 | WP_250235216.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
NBW67_RS07600 | 1666481..1667095 | - | 615 | WP_154050571.1 | cupin domain-containing protein | - |
NBW67_RS07605 | 1667190..1668059 | - | 870 | WP_003829104.1 | class I SAM-dependent methyltransferase | - |
NBW67_RS07610 | 1668297..1668662 | + | 366 | WP_065474609.1 | YccF domain-containing protein | - |
NBW67_RS07615 | 1669206..1670471 | + | 1266 | WP_136500160.1 | Fic family protein | - |
NBW67_RS07620 | 1670569..1670724 | - | 156 | WP_019728038.1 | hypothetical protein | - |
NBW67_RS07625 | 1670942..1671240 | + | 299 | Protein_1492 | IS256 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 108 a.a. Molecular weight: 11874.64 Da Isoelectric Point: 4.5781
>T295437 WP_250235216.1 NZ_OW703833:1665941-1666264 [Bifidobacterium longum subsp. infantis]
MERGEIWTLQADGYASKPRPLVIVQSDAVDRFDSVITCLLTSYDSSDIDTRVRLEPSPENGLNKVSYVMTDKIVTVDRKL
LGYQVGVVDDAAMANIGRQLMRVLGLL
MERGEIWTLQADGYASKPRPLVIVQSDAVDRFDSVITCLLTSYDSSDIDTRVRLEPSPENGLNKVSYVMTDKIVTVDRKL
LGYQVGVVDDAAMANIGRQLMRVLGLL
Download Length: 324 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|