Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/RelB(antitoxin) |
Location | 1606685..1607324 | Replicon | chromosome |
Accession | NZ_OW703833 | ||
Organism | Bifidobacterium longum subsp. infantis isolate hadza_2261_Bf14 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | W6EZW1 |
Locus tag | NBW67_RS07290 | Protein ID | WP_014484977.1 |
Coordinates | 1606968..1607324 (+) | Length | 119 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | - |
Locus tag | NBW67_RS07285 | Protein ID | WP_003829235.1 |
Coordinates | 1606685..1606981 (+) | Length | 99 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NBW67_RS07260 | 1601759..1602214 | - | 456 | WP_012577916.1 | Holliday junction resolvase RuvX | - |
NBW67_RS07265 | 1602223..1604901 | - | 2679 | WP_250231665.1 | alanine--tRNA ligase | - |
NBW67_RS07270 | 1605030..1605266 | - | 237 | WP_047379873.1 | hypothetical protein | - |
NBW67_RS07275 | 1605266..1605664 | - | 399 | WP_012577919.1 | DUF948 domain-containing protein | - |
NBW67_RS07280 | 1605747..1606421 | - | 675 | WP_065456637.1 | histidine phosphatase family protein | - |
NBW67_RS07285 | 1606685..1606981 | + | 297 | WP_003829235.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
NBW67_RS07290 | 1606968..1607324 | + | 357 | WP_014484977.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
NBW67_RS07295 | 1607501..1608103 | - | 603 | WP_250235166.1 | transglutaminase family protein | - |
NBW67_RS07300 | 1608208..1608564 | - | 357 | WP_038426137.1 | SdpI family protein | - |
NBW67_RS07305 | 1608648..1609088 | + | 441 | WP_250235168.1 | cytidine deaminase | - |
NBW67_RS07310 | 1609271..1610053 | + | 783 | WP_144098495.1 | gamma-glutamyl-gamma-aminobutyrate hydrolase family protein | - |
NBW67_RS07315 | 1610233..1610859 | - | 627 | WP_007052130.1 | 30S ribosomal protein S4 | - |
NBW67_RS07320 | 1611058..1612050 | - | 993 | WP_081356789.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 119 a.a. Molecular weight: 13302.25 Da Isoelectric Point: 8.9603
>T295436 WP_014484977.1 NZ_OW703833:1606968-1607324 [Bifidobacterium longum subsp. infantis]
MMKTDPRQFEIWWVPFAFPDKPGKAKNRPSVILQWDDGTRIALVTKVTGNTWRDEPGYVVLRDWQDAGLSKPSAVRCSQL
LRLPSNLFLDDGPTGRLSAYDAGRVAWAINELYPGLLA
MMKTDPRQFEIWWVPFAFPDKPGKAKNRPSVILQWDDGTRIALVTKVTGNTWRDEPGYVVLRDWQDAGLSKPSAVRCSQL
LRLPSNLFLDDGPTGRLSAYDAGRVAWAINELYPGLLA
Download Length: 357 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|