Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/YafQ-RelB |
Location | 1495765..1496331 | Replicon | chromosome |
Accession | NZ_OW703833 | ||
Organism | Bifidobacterium longum subsp. infantis isolate hadza_2261_Bf14 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A0L7BQL3 |
Locus tag | NBW67_RS06765 | Protein ID | WP_029680114.1 |
Coordinates | 1496038..1496331 (+) | Length | 98 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | NBW67_RS06760 | Protein ID | WP_143723361.1 |
Coordinates | 1495765..1496034 (+) | Length | 90 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NBW67_RS06735 | 1491516..1492202 | - | 687 | WP_013140734.1 | response regulator transcription factor | - |
NBW67_RS06740 | 1492334..1492852 | + | 519 | WP_223261719.1 | hypothetical protein | - |
NBW67_RS06745 | 1492849..1493739 | + | 891 | WP_007056280.1 | hypothetical protein | - |
NBW67_RS06750 | 1493736..1494414 | + | 679 | Protein_1314 | ABC transporter ATP-binding protein | - |
NBW67_RS06755 | 1494420..1495580 | + | 1161 | WP_032742829.1 | ABC transporter permease | - |
NBW67_RS06760 | 1495765..1496034 | + | 270 | WP_143723361.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
NBW67_RS06765 | 1496038..1496331 | + | 294 | WP_029680114.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
NBW67_RS06770 | 1496388..1496693 | + | 306 | WP_234883664.1 | transporter | - |
NBW67_RS06775 | 1497064..1498644 | + | 1581 | WP_143723360.1 | amino acid permease | - |
NBW67_RS06780 | 1498886..1499125 | - | 240 | WP_014483708.1 | hypothetical protein | - |
NBW67_RS06785 | 1499422..1499775 | + | 354 | WP_014483707.1 | DUF488 domain-containing protein | - |
NBW67_RS06790 | 1499841..1500269 | - | 429 | WP_032743755.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 98 a.a. Molecular weight: 11160.90 Da Isoelectric Point: 9.7881
>T295435 WP_029680114.1 NZ_OW703833:1496038-1496331 [Bifidobacterium longum subsp. infantis]
MLKPDYTAAFQRDIKKLKRKHADLRPLKEVIRLVLEDTADSKEALRRRHRAHTLTGDLNGVLECHIGNAGDWLLLWIRDD
GTAMFMRTGSHDELLGK
MLKPDYTAAFQRDIKKLKRKHADLRPLKEVIRLVLEDTADSKEALRRRHRAHTLTGDLNGVLECHIGNAGDWLLLWIRDD
GTAMFMRTGSHDELLGK
Download Length: 294 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|