Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/YafQ-DinJ |
| Location | 23349..23914 | Replicon | chromosome |
| Accession | NZ_OW703833 | ||
| Organism | Bifidobacterium longum subsp. infantis isolate hadza_2261_Bf14 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | A0A1S2W0Z4 |
| Locus tag | NBW67_RS00080 | Protein ID | WP_065472908.1 |
| Coordinates | 23349..23639 (-) | Length | 97 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | B7GSH1 |
| Locus tag | NBW67_RS00085 | Protein ID | WP_012576473.1 |
| Coordinates | 23636..23914 (-) | Length | 93 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NBW67_RS00065 | 19213..20772 | - | 1560 | WP_174773587.1 | iron ABC transporter permease | - |
| NBW67_RS00070 | 20867..21925 | - | 1059 | WP_250235260.1 | ABC transporter substrate-binding protein | - |
| NBW67_RS00075 | 22057..22938 | - | 882 | WP_250235262.1 | MurR/RpiR family transcriptional regulator | - |
| NBW67_RS00080 | 23349..23639 | - | 291 | WP_065472908.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
| NBW67_RS00085 | 23636..23914 | - | 279 | WP_012576473.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| NBW67_RS00090 | 24162..24623 | + | 462 | WP_143723922.1 | hypothetical protein | - |
| NBW67_RS00095 | 24829..25095 | - | 267 | Protein_18 | transposase | - |
| NBW67_RS00100 | 25363..26004 | + | 642 | WP_250235264.1 | hypothetical protein | - |
| NBW67_RS00115 | 27338..28600 | - | 1263 | WP_065436594.1 | metallophosphoesterase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 10925.63 Da Isoelectric Point: 9.9583
>T295433 WP_065472908.1 NZ_OW703833:c23639-23349 [Bifidobacterium longum subsp. infantis]
MSGIRYTVKTTSRFRKDFKLARRRGLDADLFKQVVSILSEGGTLPDRYHDHALTGNMTGFRECHITPDLLLVYLIEKDVL
VLTLTRTGTHSDLFGK
MSGIRYTVKTTSRFRKDFKLARRRGLDADLFKQVVSILSEGGTLPDRYHDHALTGNMTGFRECHITPDLLLVYLIEKDVL
VLTLTRTGTHSDLFGK
Download Length: 291 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1S2W0Z4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0A8MHE5 |